KEGG   Xylella fastidiosa M23: XfasM23_0871Help
Entry
XfasM23_0871      CDS       T00692                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
xfn  Xylella fastidiosa M23
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xfn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1024313..1024924)
Genome map
AA seq 203 aa AA seqDB search
MDHSKQQNASITQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDPHD
YLQRTFEEISCYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVES
YARRFQIQEKMTAQIAACIQDTLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTF
REDARTRAEFLQFIEVGTNVIDL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaccattccaaacaacaaaacgcatccatcacccaagctcaggcagaagaggccgta
cgcacacttctacgttgggccggcgaagatcccactcgtgaaggcttgctcgacacacca
cgccgtgtcgttgaagcatacggagattggttcagcggttaccgcgaagatcctcatgac
tacctgcaacgcactttcgaggaaatctcttgctacgacgagatgatcgtactacgtaac
attacctatgaaagccactgcgaacatcacatggcacccatcatcggtaaagttcacgtt
ggctacttgccaaacggcaaagtcgtcggcatcagcaaattagcacgcgttgttgaatcc
tatgcgcgccgcttccagatacaggaaaaaatgactgcgcaaattgcagcatgtatccaa
gacacattgaccccacgtggcgtcggtgtcgtgattgaaggtgcacacgcatgtatgact
acccgaggtatacacaagcgtggtgtatcaatggtcacctcaaagatgctcggcaccttc
cgcgaagacgcacgcacccgcgccgagttcttacagttcatcgaagtaggtaccaacgtg
atcgacttatga

DBGET integrated database retrieval system