KEGG   Xylella fastidiosa M23: XfasM23_0942Help
Entry
XfasM23_0942      CDS       T00692                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xfn  Xylella fastidiosa M23
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xfn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1107379..1107963
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGVLTSKTPPWLVVDVCGVGYELEVPMSTFCELPDVGYEVNLFTHYTQKDDSAAL
YGFLSESERRLFRHLQRVSGIGTKIALAILSSVSVDTFAGLIQAGDANALTVIPGVGKKT
AERMLVELRDRAADFNNGISTSGKLNLDTVSEAALALQQLGYKPAEAARMARDAGTESDD
VAIVIKKALQTVLR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgcttgcgaggggttttgactagcaaaacgccaccgtggctcgtggttgat
gtgtgtggagttggctacgaactagaggtgccgatgagcactttttgcgaattgccagac
gtcggttacgaggtgaatttgtttactcactatacgcagaaggatgatagtgccgcgttg
tacggttttctgagcgaaagtgagcggcggctattccgccacctgcagcgggtgagtggt
atcggtaccaagatcgctttggcgattctatccagcgtcagcgtggatacatttgcgggg
ttaatccaggctggtgacgctaatgcattaacggttatcccaggagttgggaagaaaacc
gctgaacgtatgctggtggagttgagagaccgtgctgcagacttcaacaatggtatttcc
acctcaggcaagctcaatcttgatacggtatctgaagctgccttggctttgcagcaactc
ggttataagccagctgaggctgcacgtatggcacgtgatgccggtactgagagcgatgat
gttgctattgtcatcaaaaaagcgcttcaaaccgtattacgttga

DBGET integrated database retrieval system