KEGG   Xylella fastidiosa M23: XfasM23_1053Help
Entry
XfasM23_1053      CDS       T00692                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xfn  Xylella fastidiosa M23
Brite
Enzymes [BR:xfn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     XfasM23_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1208920..1209417)
Genome map
AA seq 165 aa AA seqDB search
MQTIGEEGIALIKFFEGCKLSPYTCPGGVLTIGYGETGKHVVPGLRLTNEQEADARLRAR
LAKEFEPAVRRHVKVTLAQHQFDALVSLSFNIGVGAFHRSTLLRKLNAGDVAGAAEQFHV
WKWAGGRVQSGLVRRRKAERWLFEGKDWQAALAAEHAAVKKASRD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccattggtgaagaaggcattgcactcatcaagttttttgagggttgtaagctg
agtccgtacacctgtcctggtggtgtgttgacgattggctatggtgagacgggcaagcac
gtcgtaccagggttgcggcttaccaatgagcaggaagcagatgcgcggttacgtgcacgc
ttagcgaaagaatttgagccggcggtacggcgacatgtgaaggtgactttggcgcaacat
caatttgatgcgctggtgtcgctgagcttcaacattggtgtgggcgcgtttcaccgctcg
acgctgttacgcaagcttaatgccggtgatgtggctggtgcggcggagcagtttcatgtg
tggaaatgggcgggcggtcgtgtgcagtctggtttagttcggcgtcgaaaagccgaacgt
tggctatttgaaggtaaagattggcaggccgcattagcagccgagcatgcggcggtgaag
aaggcatcacgtgattga

DBGET integrated database retrieval system