KEGG   Xylella fastidiosa M23: XfasM23_1121Help
Entry
XfasM23_1121      CDS       T00692                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XfasM23_1121
DNA repair and recombination proteins [BR:xfn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     XfasM23_1121
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XfasM23_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 TniQ HHH
Motif
Other DBs
NCBI-ProteinID: ACB92549
JGI: XfasM231121
UniProt: B2I5A6
Position
complement(1269864..1270460)
Genome map
AA seq 198 aa AA seqDB search
MSTHLLEQLIDAFRILPGVGQKTAQRMAYHMLEREREGGQRLADVLSRAIEKIGHCTECR
DFSETKICAICANSSRDRHQLCVVESPPDRLAIEQATGYRGLYFILQGRLSPLDGIGPHE
LGLDHLGQRLAAGEVTELIIATNATVEGETTAHYLALLARQHGIRPSRLAQGLPLGGELE
YLDRGTLSHAFGTRTEVV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacatttgcttgagcagttaattgacgccttccgtatcttgccaggtgtcggt
cagaagaccgcgcagcgtatggcctaccatatgcttgagcgcgagcgtgaaggtggacag
cgcttggctgatgtgctgagccgtgcgattgagaaaattggtcattgtacggagtgtcgt
gacttcagtgagaccaaaatctgtgcgatctgcgctaactccagccgtgaccgtcatcag
ttgtgcgtggtcgagtccccccctgatcggctggcgattgagcaagccactggctaccgt
ggactatattttattttgcaggggcgcctgtccccgctggatgggatcggccctcatgaa
cttgggttggaccatttaggacaacgtcttgctgcaggtgaggtgacggagctcatcatt
gcgactaatgcgacggtggagggtgagacgacagcgcactacttagcgctcctggcgcgc
caacacggtatacgccccagccgactggcacaaggtttgcccttgggtggggagctggaa
tacttagaccgcggcactctttcgcacgcgttcggcacccgtactgaagtggtctga

DBGET integrated database retrieval system