KEGG   Xylella fastidiosa M23: XfasM23_1246Help
Entry
XfasM23_1246      CDS       T00692                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xfn  Xylella fastidiosa M23
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XfasM23_1246
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XfasM23_1246
Enzymes [BR:xfn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XfasM23_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1382015..1382593)
Genome map
AA seq 192 aa AA seqDB search
MNMLNVLRFPVLALALAFVSSGVLADVGSLLDLDYRPLAGKETVNLQRLYGGKVLLVVNT
ASKCGFTPQYEGLEALHQKLSPLGFAVLGFPSNDFKGQEPGDEQQIQEFCTLTYGVKFPM
FQKVHVKGNEVTPLYQRLTQTTGVAPGWNFHKYLIARDGHVVAQFDSRTRPDDPILLEAI
KRELAKSVQVVH
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgctcaatgtgttgaggtttcccgttttggctttggctttggcttttgtttct
agtggtgtactggccgatgtggggagtttgctggatttggattaccgtccgttggccggt
aaagagactgtcaatttgcagcgcctttatggtggcaaggtgctgttggtggtcaatacc
gccagtaaatgtggttttaccccgcaatacgaaggattagaggcattgcaccagaaattg
tcgccacttggttttgctgtacttggttttccatccaacgactttaaggggcaagaacca
ggtgatgagcagcaaattcaggaattctgcacgctgacgtatggggttaagtttccaatg
tttcagaaggttcacgtcaaaggcaatgaggtcacgccactgtatcagcgcttgacgcag
acgacgggtgtggcaccgggctggaactttcacaagtacctcattgcgcgtgatggccat
gttgtggctcagtttgatagccgtacgcggcctgatgatccaattctgttggaagcgatc
aagcgtgagttggcaaagtcggtgcaggtagtgcactga

DBGET integrated database retrieval system