KEGG   Xylella fastidiosa M23: XfasM23_1344Help
Entry
XfasM23_1344      CDS       T00692                                 

Definition
acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xfn  Xylella fastidiosa M23
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XfasM23_1344
Enzymes [BR:xfn01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     XfasM23_1344
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     XfasM23_1344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1483396..1483962
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFDDHTPDTPFFVSKEQAQITAELHKIGITFERWEATQAIEPGATAEQVMAAYRT
DIDRLIATHGFKTVDVISIAPDNAKREEMRAKFLEEHFHKEDEVRFFVAGSGLFTVHSGN
KVYEIECVKNDLIAIPDGTLHWFDMGAAPYFVAIRFFTEPDGWVGHFTGTDIAQRFPRYI
PEGCQSAH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactacgcatcttcgacgatcacacccccgatacgccgttcttcgtcagcaaa
gagcaggcacagatcaccgccgagttgcacaagattggcatcacgttcgagcgctgggaa
gcgactcaagcgattgaacctggtgcaactgcagagcaggtcatggcggcctaccgtact
gacattgatcggctgatcgccacacatggtttcaaaaccgtagacgtgatcagcatcgct
ccagacaatgccaagcgcgaagagatgcgcgccaaatttcttgaggaacattttcacaag
gaagatgaggtccgtttcttcgttgctggctcgggattattcaccgtgcacagcggcaac
aaagtctatgaaatcgaatgcgttaaaaacgatctgatcgcaatacccgatggcaccctg
cactggtttgatatgggtgccgcgccctacttcgtcgctatccgcttttttaccgaaccg
gatggctgggttggccatttcaccggcactgacattgcacaacgcttcccccgctatatc
cccgagggctgccaaagcgcgcactga

DBGET integrated database retrieval system