KEGG   Xylella fastidiosa M23: XfasM23_1356Help
Entry
XfasM23_1356      CDS       T00692                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xfn  Xylella fastidiosa M23
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XfasM23_1356
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XfasM23_1356
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XfasM23_1356
Enzymes [BR:xfn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XfasM23_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1494968..1496269)
Genome map
AA seq 433 aa AA seqDB search
MIQMNFHSTRTTAPVTTLSQAIAAGLAPDGGLYVPECLPPLGDLDHSADLINTATALLTP
FFAGDPLEVHVPSICAEALDLPAPLLPLATPEDYVLELFHGPTAAFKDFGARFLAACLTR
LRRDAERPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIH
TLRVAGVFDDCQAMVKQALNDTSLQTAVPLSSANSISLGRLLPQMSYYAHAALTHRASTG
RPLNLIVPTGNLGNALAAILARALGVPLGQIVLATNANHVLPDYFSGAHYRPQPSVATLA
NAMDVGAPSNFERLRWLYRGDDAALRAAFTAYSVDDTAIRQTITARHRRYDEIFCPHTAT
AVFVLEHLRAQGVAGDWAVVATAHPAKFEQVVEPLIGTTVPVPAALDSLLQRPARDEPLA
PEYPALRHMLLAT
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatgaacttccattccacccgcaccacagctccggtgaccaccctcagccag
gcaatcgctgcaggcttagcaccggatggcggcttatatgtccccgagtgcttgccaccc
cttggtgacttggaccacagcgcagatttaatcaacaccgccaccgcactactgaccccc
ttctttgcgggggatccgctagaagtgcatgtgccgtcgatctgtgccgaagcgctggat
ctccccgcaccactgctgcccttggctacccctgaagattatgtccttgagttatttcac
ggccccactgctgccttcaaggattttggcgcacgttttctagcggcctgcctgactcgg
ctacgacgtgatgccgaacgtcccttgacgattctggtggctacctccggtgatacgggt
gctgcggtggcggcggcatttcatcggcaacccggattgcgtgtcgtcgttctgtacccg
gatggccgtgtatcgccacgtcaggcccaccaattgggttgttttggcgacaacatacat
acactgcgtgtggctggcgtgttcgatgactgccaagccatggtcaagcaggccctgaac
gataccagcctccaaacagccgtgccgctgagttcggccaacagcatcagcctgggccgc
ttgctgccgcagatgagctactacgcccatgcagccttgacccaccgtgccagcacgggc
cgccctctgaacctcattgtgcccaccggcaacctcggcaatgccttggccgcgattctg
gcgcgcgccctgggagtacccttaggacagattgtgttggcgacaaacgccaaccacgta
ctccctgattacttttccggagcacattaccgcccccagcccagtgtggcgacgttggcc
aatgcaatggacgttggagcgcccagtaattttgaacgattgcgctggttgtatcgcggc
gatgacgccgcattgcgtgccgcctttaccgcctattccgtcgacgacaccgcgatccgc
cagaccatcaccgcacggcatcgtcgctacgacgagatattttgtccccataccgctacg
gcggtgtttgtgcttgagcacttgcgtgcacagggcgtcgctggggattgggccgttgtg
gcgaccgcgcatccagccaaatttgagcaggtggtagaaccgttgatcggtaccaccgtg
cccgtgccggcggccctggatagcctcctgcaacgtcccgcgcgcgacgaaccgcttgcc
ccagagtacccggcattgcggcacatgctactggccacctaa

DBGET integrated database retrieval system