KEGG   Xylella fastidiosa M23: XfasM23_1381Help
Entry
XfasM23_1381      CDS       T00692                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00010  Glycolysis / Gluconeogenesis
xfn00620  Pyruvate metabolism
xfn00640  Propanoate metabolism
xfn00680  Methane metabolism
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01120  Microbial metabolism in diverse environments
xfn01130  Biosynthesis of antibiotics
xfn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XfasM23_1381
   00620 Pyruvate metabolism
    XfasM23_1381
   00640 Propanoate metabolism
    XfasM23_1381
  Energy metabolism
   00680 Methane metabolism
    XfasM23_1381
Enzymes [BR:xfn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     XfasM23_1381
Lipid biosynthesis proteins [BR:xfn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   XfasM23_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACB92799
JGI: XfasM231381
UniProt: B2I610
Position
1530122..1532065
Genome map
AA seq 647 aa AA seqDB search
MSDLYTIDPMLAKDAHIDRAHYKTLYHESIEQPEAFWNKVSQRLEWFKAPTKIKNVSYQL
EDVHIRWFEDGELNASVNCLDRHLTLRGDKTALLFEPDAPDAPSSRITYRELYERVCQLG
NALRHLGIEKGDRVTIYLPMIPDAVVAILACARIGAIHSVVFGGFAANSIADRVNDCGSK
LIITADEGLRGGRKIPLKANVDAALKIHGTQSVETVLVVRHTGSTINMHTPRDRWFHDLV
DIQATECAPERMNAEDSLFILYTSGSTGKPKGVLHTTGGYLVYTSYTHETVFDLRENDIY
WCTADIGWITGHSYIVYGPLANGTTVLLFEGTPHYPTVSRFWEVIDKHHVTLFYTAPTAI
RALMREGDTPVKKTSRKSLRLLGSVGEPINPEAWHWYYTIVGNGRCPIVDTWWQTETGGI
LITPLIGATDLKPGSVTLPFFGIRPALVDTNGQTLDGPAAGNLVLLDSWPGQMRTLYGDH
QRFIDTYFRTYPNTYFTGDGCRRDADGYYWITGRVDDVINISGHRIGTAEIESTLVAHPK
VAEAAVVGFPHPIKGQGIYAYVTLITGETPSEALHQELLTWVRKEIGAIAIPDHVQWASN
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSIVDLLLNERLKH
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctgtacaccattgatccgatgttggccaaagatgcgcacatagaccgtgcg
cactacaaaacgctttaccacgaatccatcgaacaaccagaagcattctggaacaaagtc
tcacagcgcctggagtggtttaaagcgccgaccaaaatcaaaaatgtcagctaccaactg
gaagatgttcacatccgttggttcgaagacggtgaactcaatgccagcgtcaactgcctg
gaccgccatctcaccttacgtggcgacaaaacagcactcctgtttgaacctgacgcccca
gacgccccatcctcacgcatcacctaccgtgaactatacgagcgcgtctgccaactcggt
aacgcactgcgtcacctcggcatcgaaaagggcgaccgcgtcaccatctacttaccaatg
attccagatgcagtcgtcgccatcctcgcttgcgcacgcattggagcaatccactccgtc
gtcttcggcggttttgcagcaaactccattgccgaccgagtgaatgactgcggtagcaaa
ctcatcatcaccgcagatgaaggcctgcgtggtggcagaaaaattccattgaaagccaat
gtcgatgccgcattaaaaatccacggaacccagtccgtcgaaaccgtactcgtcgtgcgt
cacaccggcagtacgatcaacatgcataccccgcgcgaccgctggttccatgacctcgtc
gacatccaagcaaccgaatgcgccccagaacgcatgaacgctgaagactcccttttcatc
ctctatacctccggctccacaggcaaacccaaaggagtcctgcacaccaccggcggctac
ctggtgtacaccagctacactcatgaaaccgtgtttgacctacgcgaaaacgacatctac
tggtgcactgccgacatcggctggattactggtcacagctacatcgtttacggcccccta
gccaatggcaccaccgtcttgctgtttgaaggcaccccccactacccaaccgtgtcgcgc
ttctgggaagtgatcgacaaacatcacgtcaccctcttctacaccgcgccgaccgcaatc
cgtgcattgatgcgcgaaggcgacactcctgtaaaaaaaacctcccgcaaaagcttgcgg
ttacttggcagcgttggcgaacccatcaaccccgaagcctggcactggtactacaccatc
gttggcaacggacgttgtcccattgtcgacacctggtggcaaaccgagacaggaggaatc
ctcatcaccccactgatcggtgcaaccgaccttaaaccaggctcagtcaccctccccttc
ttcggcatacgccccgccctagtggataccaacggacaaacactggatggccccgcagca
ggtaacctagtcctgctcgattcctggccgggtcaaatgcgtaccctctacggtgaccac
caacgttttatagacacttactttcgcacctaccccaatacttacttcaccggcgacggc
tgccgccgcgatgccgacggctattactggatcactggacgtgttgatgacgtcatcaac
atctccggccatcgcatcggcaccgccgaaatcgaaagcacactcgtcgctcaccccaaa
gtggctgaagccgcggtcgtcggcttccctcacccgatcaaaggccagggcatctacgca
tacgtgacattaattaccggcgagacacccagcgaagcactgcaccaagaactgctcacc
tgggtacgcaaagaaatcggagcaatcgccatacccgatcacgtgcaatgggcatccaac
ctccccaaaacccgctccggaaagatcatgcgccgcatcctgcgcaaaattgcagaaaac
gcaccagaccaactcggtgacacctccacactagctgatccgtctatcgtcgacttattg
ctcaacgaacgactgaaacactga

DBGET integrated database retrieval system