KEGG   Xylella fastidiosa M23: XfasM23_1389Help
Entry
XfasM23_1389      CDS       T00692                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xfn  Xylella fastidiosa M23
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    XfasM23_1389 (glpK)
Enzymes [BR:xfn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     XfasM23_1389 (glpK)
Exosome [BR:xfn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XfasM23_1389 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1544536..1546035
Genome map
AA seq 499 aa AA seqDB search
MKKKYILAIDQGTTSSRAILFDHKGRIIGMAQREFTQIFPQPGWVEHNPRDIMTSVYTTI
TELLNNTQIDVRAIAGIGITNQRETTVIWDRQTGQPIYNAIVWQSRQTKDICDQLTTAGY
QDMVHAKTGLLIDAYFSGTKVKWILDHVENAHTQAARGELAFGTIDTWIIWNLTGGQVHV
TDYSNASRTLLYDIHALRWDPDLLTMLDIPAAILPDVRSSSEIYGLTQTPYFHGEQIPIA
GIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMHTGKKAVESQNGLLTTIAWGLNGEIEY
ALEGSIFIAGSVVQWLRDGLRMFGKASDSQAYADRVSDNGGVYVVPAFVGLGAPYWRSDV
RGAVFGLTRSTTKEHFVRAALESMAYQTRDVLSAMQADADIELKELRTDGAAITNDFMAQ
FQSDILAVPVLRSQIAETTALGAAYLAGLATGFWSSREEMTQHWAINRCFKPQMDKEQRE
HLYAGWKQAVEATLGFRVA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaatacatactggccattgaccaaggcaccaccagctcccgggccattctg
tttgaccacaaaggccgcatcatcgggatggcacagcgggaattcacccagatatttccc
caacctggctgggtcgaacacaacccgcgcgacatcatgaccagtgtgtacaccacgatc
accgaactgctcaacaacacccagattgacgtgcgcgccatcgccggaatcggtattacc
aaccaacgcgaaacaaccgtcatctgggatcgtcagaccggccaaccgatctacaacgca
atcgtttggcaatcacgccaaaccaaggacatctgcgaccaactcacgaccgccgggtac
caagatatggttcacgccaaaaccggactcctgatcgacgcctatttttcaggcaccaag
gtgaaatggattctggaccatgtcgaaaacgcacatacacaagcagcgcgcggagaactg
gcattcggcaccatcgacacctggatcatctggaacctgaccggcggccaagtccatgtc
accgattacagcaacgcctcacgcaccctgctgtacgacatccacgccctgcgttgggat
ccagacctgctgacaatgctagacataccagcggcgatcctgccggacgtccgttcatcc
agcgaaatttacggtctcacccaaaccccgtatttccacggagaacagataccgattgcc
ggaatcgccggcgatcagcaagccgcactcttcggccaagcctgtttcgaacctggcatg
gccaaaaacacctacggcaccggctgtttcatgctcatgcacaccggcaaaaaagccgtg
gaatcccaaaatggactactcactacgatcgcttggggcctgaatggagaaatcgagtac
gcactagaaggctcgatcttcatcgctggctctgtggtgcaatggctgcgcgatggatta
cgcatgttcggcaaagccagcgattcacaagcctacgccgaccgtgtcagcgacaacggc
ggcgtatacgttgtaccggccttcgttggcctgggtgcgccctactggcgtagcgatgtc
cgcggcgcagtgttcggactgacacgcagcaccaccaaagaacacttcgtccgcgccgca
ctagaatcaatggcctaccaaacccgcgacgtcctgagcgcaatgcaggcagatgcagac
atcgaactcaaagaactacgcactgacggcgcggccatcaccaacgacttcatggcccaa
ttccagagcgatatcctcgccgtgccagtgctgcgctcgcagatcgccgaaaccacagca
ctcggtgccgcctacctggctggacttgcgaccggattttggtccagccgcgaagagatg
acgcaacactgggcgatcaatcgctgcttcaagccacagatggataaggaacaacgcgag
cacctatacgcaggctggaaacaggccgtcgaagccacattaggtttccgtgtggcctga

DBGET integrated database retrieval system