KEGG   Xylella fastidiosa M23: XfasM23_1391Help
Entry
XfasM23_1391      CDS       T00692                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xfn  Xylella fastidiosa M23
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xfn00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1547328..1548194
Genome map
AA seq 288 aa AA seqDB search
MFDIPGLSTGDFHGFPSLLIQTPFSHAAISLFGGQLLSFVPSGGEEVMWLSPLVQPPPTA
IRGGIPVCWPYFGRQGQRDTMPAHGFVRTVPWQQVESCQENDGSLFLVMAPPPLKHLGLH
LRMTLRIGRTLEQELATENISHAPISFTQALHNYFRVSNALQVTVQGLDGVEYLDKFEGY
TQRHRQQGHWTLQDPHDPGRADRIYVDTSGHYVLVDPLFSRRIVLTTEGSHSLVVWNPGH
AGASNMIDVADGWRDYLCLEPANAGPDEIELLPGARHVLRQSIAIAPL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacatccccggcctgagcacaggtgatttccatggtttcccctcactgctgata
cagaccccgttctcacatgcagcgatcagtctgtttggcgggcagttgctttcatttgta
ccgagcggtggagaagaagtcatgtggctatcccccctggtccagccaccacccactgca
atccgcggcggtatcccagtctgttggccttactttggccgccaagggcaacgcgacacc
atgcccgcgcatgggttcgtgcgtactgtgccatggcaacaagtggagagctgccaagaa
aacgatggaagtctgtttctcgtcatggcaccgccaccactcaaacacctggggttgcat
ctgcggatgacactgcgtatcggccgcaccctggaacaagagttagccaccgagaacatc
agccacgctccgatcagcttcacccaagcgctgcacaactatttcagagtcagcaacgca
ctacaggtcacggtccaaggactggatggagtggaatatctggacaaattcgagggctat
acccaacgccaccgccaacagggccattggaccttacaagatccacatgatcctggccgt
gcggatcgtatctacgtcgacaccagcggccattatgtgctggtcgatccattattttcc
cggcgcatcgtgctgacgacggaaggcagccacagcctggtggtgtggaatccaggtcac
gctggtgcaagcaacatgattgatgtcgccgacggctggcgcgactatctctgcctggaa
ccagctaatgcaggaccagatgaaatcgaactgctccccggagcacgccatgtgctgcgc
cagagcatcgccatcgcaccactgtag

DBGET integrated database retrieval system