KEGG   Xylella fastidiosa M23: XfasM23_1394Help
Entry
XfasM23_1394      CDS       T00692                                 

Definition
(GenBank) Nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00760  Nicotinate and nicotinamide metabolism
xfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    XfasM23_1394
Enzymes [BR:xfn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     XfasM23_1394
    3.5.1.-  
     XfasM23_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase DUF3197
Motif
Other DBs
NCBI-ProteinID: ACB92812
JGI: XfasM231394
UniProt: B2I623
Position
1551901..1552527
Genome map
AA seq 208 aa AA seqDB search
MHPENVALIVVDLQPDFMPGGALPCEEGASIVPGIAALLDARQYSTIVATQDWHPADHVS
FASQHPAQRPFEQITLYGQPQTLWPDHCIQGSAAAGLDSRVDWRAADLILRKGTRRDTDS
YSAFRENHGPNGDRPATGLAGWLRERGIEEVHVCGLARDYCVLWTAQDALSAGFKVRFLW
PLTRPVTPEGDAPTRKALETLGIIIDHG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctgaaaacgtcgcattgatcgtcgtcgacctacagcctgatttcatgccaggc
ggcgcactgccatgcgaggaaggtgcatccattgtccccggaatcgccgcactcttggat
gcgcgccagtactctacgatcgttgcaacgcaagattggcacccggctgaccacgtttcg
tttgcctcgcaacatcccgcacagcgaccgtttgagcaaatcaccctgtatggccaaccc
cagaccctatggcccgatcactgcatccagggcagcgccgcagcggggcttgatagccgt
gttgattggcgggcggctgatctgattttgcgcaaaggcacccgccgcgacaccgactct
tatagcgcgttccgcgaaaaccacggtcccaacggcgaccgcccggccactggtctggct
ggctggttgcgtgagcgcggtattgaagaagtccacgtctgcgggctggcccgtgactac
tgtgtcctgtggactgcgcaagatgccctctcggcaggattcaaagtccgttttctgtgg
ccgctgacacgtcccgtcacccctgagggtgacgccccaacccgtaaagcgcttgaaacc
ctagggatcatcattgatcacggctga

DBGET integrated database retrieval system