KEGG   Xylella fastidiosa M23: XfasM23_1448Help
Entry
XfasM23_1448      CDS       T00692                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00670  One carbon pool by folate
xfn00790  Folate biosynthesis
xfn01100  Metabolic pathways
Module
xfn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XfasM23_1448
   00670 One carbon pool by folate
    XfasM23_1448
Enzymes [BR:xfn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     XfasM23_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ACB92859
JGI: XfasM231448
UniProt: B2I6E9
Position
complement(1600233..1600799)
Genome map
AA seq 188 aa AA seqDB search
METHLKKARENNEYLQRVVRSAMIVSLIAALDRYRAIGRDNGLPWHLPDDLKRFKALTLG
RPVLMGRKTAHSLGRPLPGRTNLVLTRSGHVPFSEMRAVDSLDAAIVQAAAEGADTLSVI
GGGELYALTLPHANAMYLTHVDVAVAGADTYFPMFDAVDWEIKNREPHQGDGRHAYPFTF
IDYCRRLR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggagacgcatctcaagaaagccagagaaaataatgaatatctacaacgtgttgtacgt
agtgccatgattgtttccttaattgcggcgttggatcgttaccgcgccattggtcgtgat
aatgggttgccgtggcacttgccggacgatctgaagcgtttcaaagcattgactttaggt
cgaccggtgctgatgggacgcaagactgcgcattcccttggacgtcccttaccagggaga
accaatctggtattgacgcgttctggacacgtgccattttctgaaatgcgggcggtggat
tcgcttgatgcagctatcgtccaggcggctgcggagggtgccgacacgttaagtgtgatt
ggtggaggtgaactgtatgcactgactttgccgcacgccaatgcgatgtacttaactcac
gtggatgtggctgttgcgggcgctgacacgtattttcctatgttcgacgccgtcgattgg
gagatcaagaaccgtgaaccccatcagggcgatgggcgtcatgcctacccgttcaccttc
atagactattgccgccgattgcgttag

DBGET integrated database retrieval system