KEGG   Xylella fastidiosa M23: XfasM23_1792Help
Entry
XfasM23_1792      CDS       T00692                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xfn  Xylella fastidiosa M23
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XfasM23_1792
Enzymes [BR:xfn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XfasM23_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1991646..1992599
Genome map
AA seq 317 aa AA seqDB search
MHSVVVVGSFSIDHVWRCDTLPTPGATIAGRYSRGPGGKGFNQAVAACRAGARTYFICAL
GNDTDGNMARDIATKDGFTLIGESSTEPTGTGGIYVDSHGHNTIVTGAGANAVLSTHFIT
EQRALITSAWIVLAQLESPIETLETALSMAREAGRLTILNAAPANATATINLLKLADVLT
LNETEFVALLSRHVGERISPDNVATTDGNTLHALCNKLLSGSTVVITLGSAGVFVSHSEE
NLRGDTQPYYRVAAEQAHTVDTTGAGDAFNGALAASLARQPNTAFIQHIRLANSYAARST
ETEGGAVSMPILTTTQD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagtcgtcgtcgtcggctccttcagtattgatcatgtttggcgctgcgacaca
ttgcccacacctggtgcaacaattgccggccgctatagccgtggtccaggaggcaaaggc
ttcaaccaagccgtggcggcttgccgcgctggtgcgcgcacctatttcatatgcgcactc
ggcaatgacaccgacggcaatatggcacgcgacatcgccacaaaagacggcttcacactg
atcggcgaatccagcaccgaacccactggcaccggagggatctatgtcgacagccacggc
cataacactatcgtcactggcgctggtgccaacgcagtactgagcacccacttcatcaca
gaacaacgcgccctaattacctcagcatggatcgtcttggcacaactggaatcaccgata
gaaacactcgaaacggcgctcagcatggcgcgcgaagctggccgcttgaccatactcaat
gctgcccccgccaatgcaaccgccacgatcaacctactcaaattggccgacgtgctcaca
ctgaacgaaacggaattcgtcgccttgctcagccgtcacgtcggtgaaaggatcagtccc
gacaacgtcgccaccaccgatggcaacacactacacgccttatgcaacaaactactgtcc
ggcagtacggttgtcattacattaggctcggctggcgtattcgtttcacactcggaagaa
aacctgcgtggtgacacccagccctactatcgtgtggccgccgaacaggcccacaccgta
gacaccaccggagctggcgacgcatttaatggtgctttggcagcatccctggcacggcaa
ccaaacacagcgtttatccagcacatacgcctcgccaatagctatgcagcgcgctcgacc
gaaacagaaggtggagccgtatcaatgccaatattaacgactacccaagactaa

DBGET integrated database retrieval system