KEGG   Xylella fastidiosa M23: XfasM23_1910Help
Entry
XfasM23_1910      CDS       T00692                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00010  Glycolysis / Gluconeogenesis
xfn00020  Citrate cycle (TCA cycle)
xfn00620  Pyruvate metabolism
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01120  Microbial metabolism in diverse environments
xfn01130  Biosynthesis of antibiotics
xfn01200  Carbon metabolism
Module
xfn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XfasM23_1910
   00020 Citrate cycle (TCA cycle)
    XfasM23_1910
   00620 Pyruvate metabolism
    XfasM23_1910
Enzymes [BR:xfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XfasM23_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N TFX_C NQRA
Motif
Other DBs
NCBI-ProteinID: ACB93310
JGI: XfasM231910
UniProt: B2I8W9
Position
2126778..2128433
Genome map
AA seq 551 aa AA seqDB search
MTEIKEAFVPDIGDYSNVPVIEVLVAVGDTVSKGQSLITLESDKATMEVPSSTAGIIKEI
KVKVGDTLSQGHVVALIEVSEETAEVTTPMTVNTPTTRAHNTAHPEDEGSLIEVRVPDIG
DYTNVPVIEVLVAVGDTVSKDQSLITLESDKATLEVPSSATGVIKQLKVNIGDTLSQGDI
VVVLQSAESTPLTPTTNKPALPPNSSPAGDAISAPASPAGTQSTPPITFDANTVLPSKVP
YASPAVRLLARQLDVDLSRIKGSEKNGRITREDVQKFVNTTLGTGMAEGRTPSASITTNG
GLNLLPWPNVDFSKFGEIETQPLSRIKKISGANLARNWAMIPHVTQFDQADITQLEALRV
QINKENAASNKNGTGIKLTVLAFLIKASASALKKFPTFNASLDATGETLTLKKYFHIGFA
ADTPNGLVVPVIRNVDQKGIVEIAQETSDLAKKARDGKLTPADMSGGCFSISSLGGIGGT
AFTPIINAPEVAILGVSKSLIQPIWDGTQFAPKMLLPLSLSYDHRVIDGALAAHFTTYLS
QILADMRRVLL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatcaaggaagcttttgtccccgatatcggtgactacagcaacgtcccagtg
attgaagtgctagtcgctgttggcgataccgtctccaagggccaaagtttgatcaccttg
gaatctgacaaagcaaccatggaagtaccttcgtcaacagccggtatcatcaaagaaata
aaagtgaaggttggcgataccttatcccaaggccatgtcgtcgcattaatcgaagtctcc
gaagagactgccgaagtcaccacacccatgaccgttaacacgccaaccacgcgtgctcac
aacactgcacatccagaagacgaaggcagcttaatcgaagtgcgtgtccctgatattggc
gattacaccaacgtcccagtgattgaagtcctggtcgctgttggcgataccgtctccaag
gaccaaagtctaatcaccttagaatctgacaaagcaaccttggaagtgccctcctccgcc
accggtgtcatcaaacaactcaaggtcaacattggagacaccttgtcgcaaggcgatatc
gtcgttgtgcttcaaagcgcagagagcaccccactcactccaaccacaaacaaaccagca
ttgccacccaattccagccctgcaggggatgccatctccgccccagcatcccctgcaggg
acacagagcaccccaccgatcaccttcgacgccaacaccgtgctaccgtccaaggtcccc
tatgccagccccgccgtacgcctgcttgcacgccagttagacgtggacctgagccgcatc
aaaggcagcgagaaaaatggacgcattacccgcgaagacgtacagaaattcgtcaacacc
accttaggtactggtatggctgaaggcagaacaccctccgcttcaatcaccacaaatggt
ggcctcaacttactcccttggccgaatgtggatttcagcaaattcggcgaaattgaaacc
cagcctttatctcggatcaaaaagatttccggtgccaatcttgcccgcaattgggcgatg
atcccgcacgtcacccaatttgatcaggccgacatcacccaactggaagccctgcgcgta
caaatcaataaagagaatgccgcatccaacaagaacggaaccggcattaaactgactgtt
ctggctttccttatcaaagcaagcgcctcagcactgaaaaaatttccaacattcaacgcc
tcccttgatgccactggcgaaacgctcacactcaaaaaatacttccatatcggtttcgcc
gccgacacaccaaacggactcgtcgtcccggtgatccgcaacgtagaccaaaaaggcatc
gtagagatcgcacaagaaaccagcgatctcgccaaaaaagcacgcgatggcaaactcacc
ccagcagacatgagcggtggttgcttctccatcagctcactcggtggcatcggaggtacc
gcattcacacccattatcaacgcacctgaagtagcgatcctgggtgtctccaaatccctc
atccaacccatctgggatggcacacaattcgcacctaaaatgctgttgccgctgtcacta
agctacgatcaccgcgtcattgatggtgccttggccgcacacttcaccacttatctcagc
cagatactcgccgacatgcggcgcgtactgctgtga

DBGET integrated database retrieval system