KEGG   Xylella fastidiosa M23: XfasM23_1919Help
Entry
XfasM23_1919      CDS       T00692                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xfn  Xylella fastidiosa M23
Brite
Enzymes [BR:xfn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XfasM23_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2138199..2138876
Genome map
AA seq 225 aa AA seqDB search
MTAPPSLQAKAVGIGMTSQRVRDRLVERLRECGIQDERVLSTIRIVPRHLFIDEALALRA
YEDTALPIGHGQTISQPWVVARMTEAVMQVVPKKILEIGTGSGYQSAILASLGLEVYTIE
RIGKLLRQARKRFRQLGIKIRSKHDDGSTGWTEHAPYNAILVTAAAPTLIDTLIEQLAIG
GRLVAPVGTASEQALVQLTRTIDGSITHEILEPVTFVSLLPGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacctccatccctgcaagcgaaagccgtagggatcggcatgacgtcgcaacgc
gtccgagaccgcctggtcgaacgactacgcgaatgcggcatccaagacgaacgggtactc
agcaccattcgcatcgtgccacgccatttattcattgatgaagccttggcactgcgcgct
tacgaagacaccgcattgcccatcggccatggacagaccatctcgcaaccctgggtcgtc
gcacggatgaccgaagctgtcatgcaggttgtccccaaaaaaatactcgagatcggtaca
ggttccggctaccagagcgccattctggcctcactaggattggaggtgtacaccattgag
cgtatcggcaaactactgcgtcaagcacgtaagcgtttccgccagcttggcataaaaata
cgcagcaaacacgatgacgggagcaccggctggacagaacatgcaccttacaacgccatc
ttggtcacagcagcagccccgacactgatcgacactctcatcgaacaacttgcaataggc
ggacgcctggtggctcctgtcggcaccgcttcagagcaagccctagtgcagctcacacga
acaatcgacggtagcatcacacacgagattttagaaccagtcacatttgtatccctgcta
ccagggatgttggattaa

DBGET integrated database retrieval system