KEGG   Xylella fastidiosa M23: XfasM23_2068Help
Entry
XfasM23_2068      CDS       T00692                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xfn  Xylella fastidiosa M23
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2323518..2324174
Genome map
AA seq 218 aa AA seqDB search
MTIDFSIAREKMVEQQIRPWDVVDLHVLDVLAHIPREAFVPEPYRTLAYADLEIPLPGGQ
TMMKPVIEGRLLQALMLSPEEDVLEIGTGSGFLTACLASLGHEVVSLEINSALAASARTH
LDTIGLGSNVHIEQADAFTWQPERQFSVICLTGAVSTLPLQFLQWLHPNGRMFAIHGHSP
AMQAVLVRGDASTPNITSLFETDLAYLKGGEPALQFHF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgatttttccatagcccgcgaaaaaatggtcgaacagcagatccgtccatgg
gatgtggtggatctgcacgtacttgatgtactggcacacatcccacgcgaggcgttcgtc
cctgaaccataccgtaccctagcctacgcagaccttgaaatccccttacccggcggacaa
acaatgatgaaacccgtcattgaggggcgcctacttcaagccctgatgttgtcaccagaa
gaggacgtattggaaatcggcaccggcagtggtttcctcactgcctgcttggcttcactg
ggacacgaagtagtcagcctagagatcaattccgcactggccgcatcggcacgtacccac
ctagataccattggcctaggcagtaacgtacacattgagcaggccgacgctttcacttgg
caacccgaacgtcagttcagcgtcatttgcttgactggtgcagtgagcacgctgccactg
caatttctgcaatggctacaccccaacggccgtatgttcgctatacacggccactcccca
gcgatgcaagctgttctggtgcgtggagatgcctctaccccaaacatcacatccctgttt
gagaccgatctggcttacctcaaaggtggcgagccagccctccaatttcatttttga

DBGET integrated database retrieval system