KEGG   Xylella fastidiosa Temecula1: PD0055Help
Entry
PD0055            CDS       T00113                                 

Gene name
ffh
Definition
signal recognition particle protein
Orthology
K03106  
signal recognition particle subunit SRP54
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:xft03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:xft03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73166..74533
Genome map
AA seq 455 aa AA seqDB search
MFESLTQRLSGTIERLRGRGRLTEENIREATREVRIALLEADVALSVVQALIERIKIRAL
GQEVLKSLTPGQALIKVVRDELAAVMGDSASELNLNVPAPAVILLAGLQGAGKTSMVGKL
AKYLKEKRKKKVMVVSADVYRPAAIEQLRILSEQVNVLCFPSSVEQNPVDIVRAAIADAK
KSFVDVLLVDTAGRLAIDQGMMDEIKALHDTLVPVETLFVVDSMTGQDAANTAKAFSEAL
PLTGLILTKTDGDARGGGALSVRYITGRPIKFVGTGEKVDDLDVFHPDRAAKRILDMGDV
LSLVEQVEQAVDQEKTAKLAAKVAKGKKFNLNDMKEQLEQMQNMGGINSLMDKLPGMGQI
PDHLKQQVTGKEVPRMIAIINSMTQKERRNPTLLNGSRRVRIAKGSGLQPSDVNKLMKQY
QQMEKMMSKLSGGGMKGLMRGMMGAMGGRGRLPFR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagtctctcactcaacgtctttctggaaccattgagcgtctgcgtggacgcggt
cgcttgacggaagagaatatccgtgaagcgactcgtgaggttcgcattgctttgcttgaa
gctgatgtcgctttatcggtcgtacaagccttgattgagcgtatcaaaatacgggccctt
ggccaggaagtgcttaaatcattaactccaggccaagcattgattaaagttgtacgggat
gagctggcagctgtaatgggtgactctgccagcgaattgaatctcaatgttccagcacct
gcggtcatattacttgccggattacagggcgcaggaaaaaccagcatggttggtaagctg
gctaagtatttgaaggaaaagcgtaagaagaaagtcatggtagtcagtgctgatgtctat
cgtccggctgcaatcgagcaacttaggatcctttctgaacaggtgaatgtgttgtgcttc
ccatcaagtgtggagcagaatccagttgatatagtgcgtgctgcaattgctgatgccaag
aagtcttttgttgatgtgctcttggttgatactgctggccgcttagcgattgatcaaggg
atgatggatgagatcaaggcgctgcatgacacgcttgttcctgtggagaccttgtttgta
gttgacagtatgactggccaggacgctgctaacactgccaaggcatttagtgaagccttg
ccactgacaggtttaatactaaccaaaaccgacggtgatgcacgtggaggtggtgctctg
agtgtgcgttacatcactgggcgtccgatcaaatttgttggtactggtgagaaggtcgat
gacctggatgttttccatccagaccgtgctgctaagcgcatccttgacatgggggatgtg
ttgtcacttgtcgagcaggtcgaacaggcagttgatcaggagaaaactgccaagcttgct
gcgaaggtggcgaaggggaagaagttcaatctgaatgatatgaaggaacagctagaacag
atgcagaatatgggagggattaatagtttgatggataagcttccggggatggggcagatt
cctgatcatctcaagcagcaagtcactggcaaggaagtgccacgcatgattgcgatcatt
aactctatgactcagaaggagcgtcgtaatccgactctacttaacggctcgcgccgtgtc
cgcattgctaaggggtccggtctacagccttccgatgtgaataaattgatgaagcagtac
caacagatggagaaaatgatgtcaaaactttctggtggtggtatgaaaggattgatgcgg
ggaatgatgggtgccatgggtggtcgtggaaggctaccgtttcgttga

DBGET integrated database retrieval system