KEGG   Xylella fastidiosa Temecula1: PD0089Help
Entry
PD0089            CDS       T00113                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PD0089 (asnB)
Enzymes [BR:xft01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PD0089 (asnB)
Peptidases [BR:xft01002]
 Cysteine Peptidases
  Family C44
   PD0089 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111688..113379
Genome map
AA seq 563 aa AA seqDB search
MCSIFGIFNLQPSDNLQILRHQALECSQRQRHRGPDWSGVYVDVGAILVHERLAIVDPAG
GAQPLFSEDGTLALAVNGEIYNHAVLKGTLQQPYAFQTHSDCEVINALYREETPTSFLNR
LNGIFAFALWDKTTGRGLIARDPMGVVPLYWGHDQDGRLRVASEMKALVEHCPDVAQFPP
GHWYDTTTGTLVKYYERPWKNYSAVEGVQVSLQELREAFERAVHRQLMTDVPYGVLLSGG
LDSSLVAAVAARYARHRIETNDQSEAWWPRLHSFAIGLKDSPDLSAANVAAEALNTVHHG
FEYTFQEGLDVLPEVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLSGEGSDEIFGG
YLYFHKAPNAREFHEELVRKLNALYYYDCLRANKAMMAWGVEPRVPFLDREFLDVAMRMD
AQHKMVDKTSNGPQRMEKGILRAAFDGYLPPSILWRQKEQFSDGVGYGWIDGLKAHAETQ
VSDHALATAETRFQVNPPQTKEAYYYRSIFERFFPSPAAAETVPGGKSIACSSPAAIAWD
ASFATMADPSGRAVSGVHQQALL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgttccatttttggaatcttcaacctgcaacccagtgacaacctacagatactgcgt
caccaagcattggagtgctcgcaacggcaacggcatcgcggacccgattggagcggcgtt
tacgttgatgtgggtgcgattctggtgcacgaacgtcttgctatcgtcgatccagccggc
ggtgcccagccactgttctccgaggatggcaccctggcgttggcggtcaacggcgaaatc
tataaccacgctgtactcaaaggaacattgcagcagccctatgcgttccaaactcattct
gattgcgaagtgattaatgcgctttaccgcgaagaaactccaacctcgtttctgaatcgc
ttaaatggaatttttgcattcgcattatgggacaagaccaccggacgtggcctcatcgca
cgcgatccaatgggcgtggtgccgctgtactgggggcacgatcaggatggtcgcttacgc
gtcgcgtcagagatgaaagcattggttgagcattgccccgatgttgcacaattcccaccc
ggccattggtacgacaccacaacgggcacgctggtgaagtattacgaacgcccctggaaa
aactattctgcagtggaaggagtgcaggtctcactacaggaactgcgtgaagccttcgag
cgggccgtccatcgtcaactcatgaccgatgttccatacggtgtactgctgtctggtgga
ttggattcttccctggtggctgcggtggccgcacgctacgcacgccatcgcatcgaaacc
aatgatcagagcgaagcatggtggccacgtctgcactcatttgcgattggactgaaagac
tcgccagatttgagtgcggcgaacgtggctgctgaggcgttgaataccgtccaccatggt
ttcgagtacaccttccaggaggggctggatgttttacctgaagtgattcgtcacattgaa
acttacgatgtcacgacgattcgcgcatccacaccaatgttcctgctggcacgtcgcatt
aaggcgatgggagtgaagatggtgttgtcaggtgaaggcagcgatgaaatttttggcggt
tacctgtacttccacaaagcgccgaacgcacgcgagttccacgaagaattggtccgtaag
ctcaacgccctgtattactacgactgcttgcgcgccaacaaagcgatgatggcgtggggt
gtcgagccgcgcgtgccgtttttggaccgtgaatttctcgatgtggctatgcggatggat
gcgcagcataagatggtcgacaagaccagcaacggcccacaacggatggagaaaggcatc
ctgcgtgcagcgtttgacggctatttgccgccatcaatcctgtggcgacagaaggagcag
ttcagtgatggtgttggctacggttggatcgacggactgaaagcacacgctgaaacgcaa
gtgtctgaccatgcgctggcaactgccgagacacgtttccaggtgaatcctccccagacc
aaagaagcctattactaccgcagcatatttgagcgcttcttcccaagcccggcggcggct
gagacggtaccgggcggtaaatcaatcgcctgttcttcaccggcggcgattgcctgggat
gccagctttgccacaatggctgacccatccggtcgtgcagtcagcggggttcatcaacaa
gcactgctgtag

DBGET integrated database retrieval system