KEGG   Xylella fastidiosa Temecula1: PD0104Help
Entry
PD0104            CDS       T00113                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PD0104 (holC)
   00240 Pyrimidine metabolism
    PD0104 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PD0104 (holC)
   03430 Mismatch repair
    PD0104 (holC)
   03440 Homologous recombination
    PD0104 (holC)
Enzymes [BR:xft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PD0104 (holC)
DNA replication proteins [BR:xft03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PD0104 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(133969..134394)
Genome map
AA seq 141 aa AA seqDB search
MARADFYLIAKPRFLEKPLQLVCELVRKAYDTHQPTLILARDQAQAEALDDLLWAFDPDA
YIPHQIAGSDEDDDITPVLIATPDSDTPSRPLVINLRDAPWDGPCERVLEVVPADPAARE
PLRERWKHYKARGLHMNKHDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgccgacttctatttgattgccaaaccgcgctttcttgagaaaccgctgcaa
ttagtctgcgaattagtccgcaaagcctacgacacccatcagcccacactgattctggcc
cgcgaccaggcccaggccgaagcactggatgacctactgtgggcgttcgacccggacgcc
tacatcccccaccaaatcgctggcagcgacgaagacgacgacatcacccccgtattgatt
gccaccccggacagcgacaccccatcgcgcccgctggtcatcaacctacgcgacgcccct
tgggatggcccctgcgaacgcgtgttggaggtggttcccgctgatcctgcggcacgcgag
ccactgcgtgaacgctggaaacactacaaggcacgcggcctgcacatgaacaaacacgac
atgtga

DBGET integrated database retrieval system