KEGG   Xylella fastidiosa Temecula1: PD0120Help
Entry
PD0120            CDS       T00113                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PD0120 (algC)
   00030 Pentose phosphate pathway
    PD0120 (algC)
   00051 Fructose and mannose metabolism
    PD0120 (algC)
   00052 Galactose metabolism
    PD0120 (algC)
   00500 Starch and sucrose metabolism
    PD0120 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PD0120 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PD0120 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PD0120 (algC)
Enzymes [BR:xft01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PD0120 (algC)
    5.4.2.8  phosphomannomutase
     PD0120 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153214..154608
Genome map
AA seq 464 aa AA seqDB search
MVQPSLFHEDDIHGVVPSELNPGVAKLIGQAIGSAMQAKGLSDIVIGRDGRVSSSELSAA
LSDGLRHAGCNVVDIGLVPIPVVYFAACHLGVWSCVAVTGGHHPHDYNGFKIVLGGESLS
SEAMSDLYQCITNGRLYASVDSGSLSERDVVDDYIQRIADDVQLNRPLKIVVDPGHGAAE
EILSRLFKAIGADLVSLYGDIDGVSLIVHPDSGEPGNLQKLIQRVERADADLGLAFDGDA
ESLRVVTREGEVILSDSVLMLFATDVLQRNPGALVIYDAECTSKLSDYVLRNGGSPLMWK
IGHSSIKAKMRETGAELAGEMSGYFFFKERWYGFEDALYAAARLLEILAQREDNPSQVFA
ALPHAYFTAQMEQSVEGDAQACVQSFIEEVQRSVEGGVFDGARLFAFDGLRADFTDGWGL
VRVSDTASALVLRFEADTQAGLERIQSAFRTHLQALLPGQVLVF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggttcaacctagtcttttccatgaagacgatatccacggtgtggtccctagcgagttg
aacccaggtgtggcgaagttgatcggtcaagcgatcggcagtgcgatgcaggccaaaggt
ttgagtgacattgtgattggccgtgacggccgcgtgtccagttctgagttgtccgcagca
ttaagtgatggtctacgtcatgccggttgcaatgtggtagacatcggcttggtgccgatc
cctgtagtgtatttcgctgcctgccatcttggcgtttggagttgcgttgcggtcacaggg
gggcatcatcctcatgattacaacggtttcaagatcgtgcttggtggtgagtccttatcc
agtgaggcgatgagcgatttgtatcagtgcatcaccaatggtcgcttatatgcgtccgtt
gactccggcagtttgagtgagcgtgatgtggttgacgattacattcagcgtattgctgat
gatgtgcagttgaatcgtccgctgaagattgttgttgatcctggtcacggtgcggctgaa
gagatcctgtcacgtttatttaaggcgattggtgcggatctggtgtcactgtacggtgat
attgatggtgtttcccttattgtccatcctgattcgggcgagccagggaatctgcagaag
ttgattcagcgggttgagcgggccgatgccgatttgggtcttgcttttgatggggatgcg
gaaagtctcagagtggtgactcgagaaggtgaggtcattttatcggatagcgtgttgatg
ttgtttgcgacggatgtgctacagaggaatccgggtgctttggtgatctatgatgctgaa
tgtactagcaagttgtctgattatgtattgcgcaatggcggcagcccgttgatgtggaag
atagggcattcctccatcaaagctaagatgcgcgagaccggtgccgagttggctggtgaa
atgagtggctatttcttcttcaaagaacgctggtatggttttgaggatgctctgtatgcg
gcggcgcgtttgctggagatcttagcgcagcgcgaggataatccgtctcaggtgtttgct
gcattgccccatgcttatttcactgcgcaaatggagcagtctgtcgagggtgatgcgcag
gcatgtgtacagtcctttattgaggaagtgcagcgtagcgttgagggcggtgtgttcgat
ggtgctcgtttgttcgcctttgatggtttgcgtgctgatttcactgatggttgggggcta
gtacgcgtttctgacactgcatctgcactggtgttgcgttttgaggctgacacgcaggct
ggattggagcggattcagagtgcattccgcacgcatctgcaggcattactacccggtcag
gtactggtgttctaa

DBGET integrated database retrieval system