KEGG   Xylella fastidiosa Temecula1: PD0213Help
Entry
PD0213            CDS       T00113                                 

Gene name
xanA
Definition
phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PD0213 (xanA)
   00030 Pentose phosphate pathway
    PD0213 (xanA)
   00051 Fructose and mannose metabolism
    PD0213 (xanA)
   00052 Galactose metabolism
    PD0213 (xanA)
   00500 Starch and sucrose metabolism
    PD0213 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    PD0213 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    PD0213 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PD0213 (xanA)
Enzymes [BR:xft01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PD0213 (xanA)
    5.4.2.8  phosphomannomutase
     PD0213 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(270456..271805)
Genome map
AA seq 449 aa AA seqDB search
MSLPAFKAYDIRGRVPDELNEDLARRIGIALAAQLDRAAPVVLGHDVRLTSPSLQEALSA
GLRASGREVIDIGLCGTEEVYFQTQYRNAAGGVMVTASHNPMDYNGMKLVREQARPISSD
TGLFTIRDAVATDIATITPPTAAEHQYLDKSAYIAHLLSYVDSNALKPLKLVVNAGNGSA
GLIVDLLAPHLPFEFVRIFHEPDGHFPNGIPNPLLPENRDATAQAVKHHGADLGIAWDGD
FDRCFFFDHTGRFIEGYYLVGLLASVILSKHPGGKIVHDPRLIWNTVEMVEAAGGIPVLS
KSGHAFIKEKMRKENAVYGGEMSAHHYFREFSYADSGMIPWLLIAELISRSGRSLADLVE
SRMQQFPCSGEINFKITDTKTATARIMDHYTAQSPTIDHTDGISADFGDWRFNLRSSNTE
PLLRLNVETRNNAALLKQRTDEISALLRT
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcactacccgccttcaaggcctacgacatccgcggccgcgtgccagatgaattaaac
gaggacttggcccgccgcatcggcatcgcactggcggcacagttggacagagcagcccct
gtggtcctgggccacgatgtacgcctgacaagcccatcactacaagaggcactgtcagcc
ggcctacgtgccagcggccgcgaggtgattgatatcggcctctgcggcaccgaagaggtc
tatttccaaacacaatatcgcaatgcggctggtggcgtgatggtcaccgccagccacaac
ccgatggattacaacgggatgaaactcgtacgcgagcaggcacgtccgatcagctcagac
accggcctattcacaatccgcgatgctgttgccaccgacatcgcaaccattacgcccccc
actgccgcagaacatcagtatctggacaagtcagcctacattgcacacctgctgagctac
gtcgacagcaacgccctcaaaccactgaagctggtcgtcaatgccggcaacggcagtgcc
ggcctaatcgttgacctactcgccccacatctaccgttcgaattcgtgcgtatattccac
gaaccggacggccactttccaaacggcattccaaacccactgctgcctgaaaaccgcgat
gccaccgcacaagccgtcaagcatcacggtgcagaccttggtatcgcctgggacggagat
ttcgaccgctgctttttctttgatcacaccggtcgttttattgaaggttactatctcgtc
ggcctcttagcctcagtgattctgtccaaacatcctggtggaaaaatcgtgcatgaccca
cgtctcatctggaacaccgtcgaaatggttgaggctgccggcggcatcccggtactgtcc
aagagcggccatgccttcatcaaagaaaaaatgcgtaaagaaaacgccgtatacggtggt
gagatgagcgctcaccattatttccgcgaattttcctacgccgactcaggcatgatccca
tggttactgatcgccgaactgatctcacgcagcggtcgctccctggccgacctggtcgaa
agccgcatgcagcaattcccgtgcagtggtgaaatcaactttaaaatcaccgataccaaa
accgccacagcacgcatcatggaccattacacagcacaatctccgacgatcgaccatacc
gacggaatcagcgccgactttggagattggcgtttcaacctgcgcagctccaataccgaa
ccgctactacgcctgaatgtggaaacccgcaacaatgcggcactgctaaaacaacgtact
gatgaaatttcagcactgctgcgcacctga

DBGET integrated database retrieval system