KEGG   Xylella fastidiosa Temecula1: PD0245Help
Entry
PD0245            CDS       T00113                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PD0245 (tpiA)
   01230 Biosynthesis of amino acids
    PD0245 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PD0245 (tpiA)
   00051 Fructose and mannose metabolism
    PD0245 (tpiA)
   00562 Inositol phosphate metabolism
    PD0245 (tpiA)
Enzymes [BR:xft01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PD0245 (tpiA)
Exosome [BR:xft04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PD0245 (tpiA)
  Exosomal proteins of bladder cancer cells
   PD0245 (tpiA)
  Exosomal proteins of melanoma cells
   PD0245 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316260..317009
Genome map
AA seq 249 aa AA seqDB search
MRPKIVAGNWKLHGSHAFAQALVAQVAAGLPLPGVSVIILPPLLYLSDLAQRFKGEGLAF
GAQNVSHHDKGAYTGEVSAAMVADVGAHYTLVGHSERREYHHEDSELVARKFAAALSAGL
RPILCVGESLPQREAGQAEVAIAMQLAPVLALVGPQGVARGLIAYEPVWAIGTGRHADPS
QVQAMHAFIRGEIARQDARIGDSLLILYGGGIKPCNAAELFSQQDVDGGLIGGASLVADD
FLAIARATV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccaagattgtggctgggaattggaagttgcatggtagccacgcgttcgcacag
gcattggttgcgcaggtcgctgctggtttgccgctgcctggagtcagtgtgattatcttg
ccgccattgctgtatctgagtgatttggcgcagcgcttcaaaggggaaggtttggcgttt
ggtgcgcagaacgtcagtcaccatgataaaggtgcttacactggggaagtttcggcggcg
atggtggctgatgtcggtgctcattacactttggttgggcattctgaacgtcgggagtat
caccatgaggacagtgagttggtggcgcgtaaatttgctgctgctctgagtgctgggttg
cgaccaattctatgtgttggggagagtttgccccagcgtgaggctggacaggcagaggtt
gccattgcgatgcagcttgcgcctgtgttggctctggttggcccgcagggtgttgcccgt
ggcttgattgcctatgagccggtttgggcgattggtactggccgtcatgcggatccgagc
caagttcaagcgatgcacgcttttattcgtggtgaaattgcgaggcaagatgctagaatc
ggcgattctctgttgattctatacggaggcggcatcaagccttgcaatgctgctgagttg
ttttcccagcaggatgtcgatggtgggttgattggtggtgcttcgttggttgctgatgat
ttcttggctatcgctcgtgcgacggtttag

DBGET integrated database retrieval system