KEGG   Xylella fastidiosa Temecula1: PD0328Help
Entry
PD0328            CDS       T00113                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:xft00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(421696..422880)
Genome map
AA seq 394 aa AA seqDB search
MTKPIRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCRTYRPDHAVI
GDATLYTTLRDGLNAAGLATKAYAGEAALAELVASTTCDTVVAAIVGAAGLHSTLAAARA
GKRLLLANKESLVLAGMLLMREASISGAEIIPIDSEHNAIFQCLRSRTTDGVHRVTLTAS
GGPFRGHNRTMLAKITPTQAMAHPTWSMGPKISVDSATLMNKGLEVIEAHHLFGLPSEQI
DVLVHPQSLVHSLVEFIDGSTLAQLSLPDMRTTLAVGLAWPERIGSGVQGLDLMKHNRLD
FEHPDTETFSCLRLARDAMQTGGTAPAVLNAANEIAVSAFLQGRIGFLTIPALIEHALTT
LPRYEADTLETLLTVDTETRRITHAALTHFPLPL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaccgatccgcaacgtcgccgtactcggtgccactggctcaattggggcagca
gcactggatgtgctcgcacgccaccccagacagttccacgtaagcctgctagccgctggc
cagcgcgtcgatgcactgttggcattgtgccgcacgtatcgtccggaccatgcggtgatc
ggcgatgcaacgctctacaccactcttcgcgacggcctgaatgccgctggtttagccacc
aaagcgtacgctggagaagcagcattagcagaactagtcgccagcaccacatgcgatacc
gtagtggcagcaatcgtcggagcagcgggcctccattcgacactggcggcagcacgcgcc
ggaaaacgtctgttgctggcgaacaaagaatcgctggtcctggccggaatgctgctgatg
cgtgaggccagcatcagtggcgcggagatcataccgatcgatagcgaacacaacgcaatt
tttcagtgcctgcgttcgcgtactacagatggcgtgcatcgggtcactttgactgcttct
ggcggtccatttcgtggccacaaccgcacgatgctagccaagatcactcccactcaagca
atggcccacccaacgtggtcgatgggaccaaagatatcggtagattcggctacactgatg
aacaagggcttggaagtcattgaggcccaccatttgttcgggctacctagcgaacagatt
gatgtactagtgcatccacaaagtttggtgcactctctggtggagtttattgatggttcg
acgctcgctcagttaagcctgccagacatgcgtaccaccctggcagttggcctcgcctgg
ccagagcgaatcggttccggggtgcagggtttggacttgatgaagcacaacaggttggac
tttgagcatccggataccgaaacgttttcctgtctgcgtctggcacgagacgccatgcag
actggcggcacggcgcctgcggtgctaaatgctgccaatgaaatcgctgtttcagcgttt
cttcaggggcgcatcggtttcctaacaattccagcactgatagaacacgcactgactaca
cttcctcgttacgaggcagacactttggagactctactgaccgtggacacagaaacccgc
cgcatcacacacgcagcactcacccatttcccactccctctctaa

DBGET integrated database retrieval system