KEGG   Xylella fastidiosa Temecula1: PD0351Help
Entry
PD0351            CDS       T00113                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PD0351 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PD0351 (sdhD)
   00650 Butanoate metabolism
    PD0351 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PD0351 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
441173..441556
Genome map
AA seq 127 aa AA seqDB search
MSRYRTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAV
AKPWNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALTLQTMVRFIAVLGAVASVFAV
VRIALGN
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttaccgtacaccactcaaaaatgcccgtggtctaggtgctgctaaggtgggg
accgggcattttgtgttgcagcgcctcactgcgattgcattagtattgctgggagtatgg
tttttggcatttttgctgactttgcttggtgtcgactatgcagcagcggttgcagccgtc
gccaaaccttggaatgcaatattgctcattggattcctggtcgctgccttttggcatgcg
cagctcggtttgcaggtggtacttgaggattacatccacaactcttttctggctttgaca
ctccagacgatggtgagatttatcgctgtccttggcgcggtcgccagcgtttttgcggtc
gttcgtatcgcgcttgggaactga

DBGET integrated database retrieval system