KEGG   Xylella fastidiosa Temecula1: PD0517Help
Entry
PD0517            CDS       T00113                                 

Gene name
rocF
Definition
arginine deaminase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xft01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xft00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
629233..630114
Genome map
AA seq 293 aa AA seqDB search
MSIVKKKTIRMLFPQWQGGNQELYGLGARLLAWLAPETEAPMFEVNVPEFKKETPEPERG
VIYRQQLFKQYDEAYRLLEREDPDYVVIFGGDCLVDLAPFAWLNEKHHGQLGVLWIDAHP
DIKTPQDSINGHTMVLGSLLGEGDNEFAAKVKVPLKPSRVMFAGLIETGLTEQETEVIHR
LGLNVAKPEVLFDNSQTVIDWVRKEKIEKLVIHFDLDVLHPDVFRSLLFAEPEPEFDWRA
TYPVGQLRLAQVIRLIRDVAAETELVAIGITEHLPWDVWHLKESLSKVPLLNR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagttaagaagaaaacaatcagaatgctgtttcctcaatggcaaggtggaaat
caggagctatatggtttgggcgcacgtcttctggcttggttggcgccggaaacagaggcg
cctatgtttgaggtgaatgtgcctgagtttaaaaaagaaacgcccgaaccggagagaggg
gttatctacaggcagcaattattcaagcagtatgatgaagcttatcgactgttggagcgg
gaagatccggattatgtggtgatctttggtggtgattgcctggtggatttggcgcctttt
gcttggttgaatgagaaacatcatggtcagttgggtgtgttatggattgatgctcatcct
gatataaaaacaccacaggattctataaatggtcacacgatggttctgggaagtttgctg
ggtgaaggtgataacgaatttgccgcaaaggtgaaagttccgctgaagccgtccagggtg
atgtttgcagggttgattgaaacggggttgacggagcaggagactgaggtaattcatcgc
cttggactcaatgtggccaaaccggaggtgttatttgacaacagccagacggtgattgat
tgggtccgtaaggagaaaatcgagaagttggtgattcatttcgatctggacgttcttcat
cctgatgtattccgctcgttgttatttgccgagccggagccggaattcgattggcgggca
acttacccggttgggcaattgcgtttggcacaggtgatcaggttgattcgcgatgttgcc
gctgaaacggagttggtggctattggcataactgagcatcttccttgggatgtttggcac
ttgaaggagtctttaagtaaggttccattgctgaatcggtaa

DBGET integrated database retrieval system