KEGG   Xylella fastidiosa Temecula1: PD0644Help
Entry
PD0644            CDS       T00113                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xft00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:xft00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790669..791946
Genome map
AA seq 425 aa AA seqDB search
MSKIVVAGGTPLYGDVRISGAKNAVLPILCATLLADAPVEISNVPYLHDVITMINLLREL
GAGVTMNEGIEAKGRSITIDPRWVRQRVVPYDLVKTMRASVLLLGPLLACYGAAEVALPG
GCAIGSRPVDQHIRGLQSLGAEITVENGYIKASVSQGRLKGGRFVFDVVSVTGTENLLMA
AAVAQGTSVIENAAMEPEVVDLAECLITLGARVEGAGTPRIVVEGVERLNSGQYAVLPDR
IETGTFLVATAMTGGRISMQQVRPQTLDAVLGKLTEAGACIEIGADSIRLDMQGRRPCSV
NLTTAPYPGFPTDMQAQFMALNCVAEGVGVIKETIFENRFMHVDELLRLGAKIQIEGHTA
IVQGVERLSGAPVMATDLRASASLILAGLVAEGETIIDRIYHLDRGYENIERKLGVLGAS
IRRMT
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattgtagttgctggtggtaccccgctatatggggatgttcggatttccggt
gccaagaatgctgtccttcctattttatgtgccacgttgctcgctgatgcgccggtggag
atcagcaacgtaccctatctgcatgacgtgatcactatgatcaatttgcttcgtgaattg
ggtgcgggtgtcaccatgaatgaaggcattgaggcgaaaggacgttcgattacgattgat
ccgcgctgggtacgtcagcgcgtggtgccgtatgacttggtgaagaccatgcgtgcttct
gtgttgctgttgggtccgttattggcctgctatggtgccgctgaagttgcacttcctggg
gggtgtgcgattggttcacgtccggtcgaccagcacatcagaggattgcaatcacttggt
gcggagatcacggttgagaatggctacatcaaggcttctgtcagtcagggtcgattgaag
ggcggtcgtttcgtgttcgacgtggtgagtgtgacaggcactgagaacctgttgatggct
gcagctgtggctcaggggacgagcgtcattgagaatgctgcgatggagccggaggttgtc
gatttagccgagtgtttgatcactctcggtgcgcgtgttgagggtgctggtaccccacgt
atcgtggtcgaaggggtggaaaggttaaatagcgggcagtatgcagtgttacctgaccgc
attgagacgggtacttttttggtggctacagcgatgacgggggggcggattagtatgcag
caggtgcgcccgcagactctggatgcggtgctgggcaaactgaccgaggccggagcgtgc
atcgaaataggtgcagatagtatccgtttggatatgcaggggcggcgcccatgttctgtt
aatctgacaactgcaccttatcctgggtttcccactgatatgcaggctcaatttatggcg
ctgaattgtgttgcagaaggtgtcggtgtgatcaaagaaacgatctttgagaaccgtttc
atgcacgttgatgaactgttacggctcggcgccaaaattcagattgagggtcataccgcg
attgtacagggtgtcgagcgattgagcggtgcaccggtgatggcgactgaccttcgcgcc
tcggcctcattgattctggctggtttggtcgcggagggggaaacaatcattgatcgcatt
taccacctggatcgtggttacgaaaacattgagagaaaactcggagtgctgggtgcatca
atccggcgtatgacatga

DBGET integrated database retrieval system