KEGG   Xylella fastidiosa Temecula1: PD0651Help
Entry
PD0651            CDS       T00113                                 

Gene name
dsbC
Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xft  Xylella fastidiosa Temecula1
Brite
Enzymes [BR:xft01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PD0651 (dsbC)
Secretion system [BR:xft02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PD0651 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(798852..799640)
Genome map
AA seq 262 aa AA seqDB search
MYRLIAALLLGIVTLTACAQPSQPSSNKTSTTPTNTTPANVQQRVTAALNTLDPDFKPDY
IGAAPFPGFREVVVSGQILYVSDNGRYLIQAQPYDIQNKKFAVSEGLLSYRRTQLATVPQ
SQRIVFAPKNPQYTISVFTDIECGYCRKLHSEIAELNKQGIAVEYLAFPRMGLGSEDYKD
MVSVWCAADRKQALTEAKAGKKIQNKNCNNPVALEYSLGQRIGVNGTPAIFAPDGTQLGG
YLPPEKLRALLDKLAAATAKGG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgccttatcgccgccttgttgctgggtatcgtgaccctcaccgcctgcgcacaa
ccctcacaacccagctccaacaaaacgagcaccacaccaaccaacaccacgccagccaac
gtgcaacaacgcgtgactgccgccctaaacactctggacccagatttcaagccagactac
atcggtgccgcaccattcccgggtttccgtgaagttgtggtcagcggccaaattctgtat
gtcagcgacaacggccgctacctcattcaggcacaaccctacgacattcaaaacaaaaaa
tttgctgtcagcgaagggctgctttcctaccgccgcacccaactagccacagtgccccaa
tcgcaacgcatcgtgttcgcaccaaagaacccccaatacaccatcagcgtattcaccgac
attgaatgcggctattgccggaaactacatagcgaaatcgccgaactgaataaacaaggc
atcgccgttgaatacctcgccttcccacggatgggtttaggaagcgaagattacaaagac
atggtctcagtgtggtgcgccgctgatcgtaaacaagcactgaccgaagcaaaagccggc
aaaaaaatccagaataaaaattgtaataaccctgttgccttggaatacagcctaggtcaa
cgtatcggcgtcaacggcaccccagcaatcttcgccccagacggcacccagcttggcggc
tatctaccaccagaaaaactacgtgcactgctggacaaactcgccgccgccacagctaaa
gggggctga

DBGET integrated database retrieval system