KEGG   Xylella fastidiosa Temecula1: PD0680Help
Entry
PD0680            CDS       T00113                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PD0680 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PD0680 (glk)
   00052 Galactose metabolism
    PD0680 (glk)
   00500 Starch and sucrose metabolism
    PD0680 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PD0680 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PD0680 (glk)
   00524 Butirosin and neomycin biosynthesis
    PD0680 (glk)
Enzymes [BR:xft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PD0680 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(833247..834251)
Genome map
AA seq 334 aa AA seqDB search
MIPTPTRDAPNIPSFLAADVGGTHVRVSVVAAAPTCASPPQLFDVRTYRCADYPSLSTIL
NDFLGTRSAVRDCVIASAGFQRSDGTVITTNLPWPLSPHRLRADLNLAEVCLVNDFEALA
YATEDMEPAQLLHLTGPAKAQDGPRLLLGPGTGLGAALWIPNNGRPIVLPTEAGQAALPS
TTELEMQLVRHMLNNRTHVPIEHALSGPGILNVYRALCALQSVLPQHASPDAISHAAAAG
TDMLSSQTLEVFCDFLGSIVGDLVMMYGAQGGVYLAGGILPQLREPLLRSHFVERFLNKG
PMGEALQHVPVRLIEHGQLGIVGAARWYLNKKAT
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgattccgacccctacccgagatgcacccaatatcccgtcctttcttgccgccgatgtc
ggcggcactcacgtgcgcgtcagcgtggttgcagccgcgcccacgtgtgctagtccaccg
caactgttcgatgtgcgcacttaccgctgcgctgactatcccagcctcagcacaattctg
aacgacttcctcggtacaagatcagcagtacgtgattgcgtcatcgccagtgccggtttt
cagcgcagcgatggtactgttatcactaccaacctaccgtggccgctatcaccacaccgg
ctacgcgcagatctcaatctggcagaggtctgtctggtcaacgactttgaggcgctggcc
tacgcgacggaggatatggagcctgcgcaattgctgcacctcactggtccagccaaagcg
caggatggaccacgcctgttgctcggtccgggaaccggcctgggtgcagcactctggatt
cccaataacggacgccccattgtcctccccacagaagccggtcaagcagcattgccgagt
acaactgaacttgaaatgcaactggtacgacacatgctgaacaaccgcacacatgtgccg
attgagcatgccttatctgggccaggaatactcaatgtgtaccgcgccttgtgtgcgcta
cagtccgtcctcccccagcacgcgagcccagatgcgatcagtcacgctgcggcagcagga
acagacatgctgtcatcacagactctagaggtgttctgcgacttcctcggcagcatcgtt
ggtgatttggtcatgatgtacggtgcacaggggggtgtctatctggccggaggaatcctg
ccgcagctgcgtgagccgctgctacgcagtcactttgtcgaacgcttcctcaataaaggc
cccatgggtgaggcattacagcacgtcccggtgcggctgatcgaacatgggcaactcggt
atcgtaggtgcggcacgctggtacttaaataagaaagcaacttaa

DBGET integrated database retrieval system