KEGG   Xylella fastidiosa Temecula1: PD0887Help
Entry
PD0887            CDS       T00113                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xft00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PD0887 (ruvA)
Enzymes [BR:xft01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PD0887 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1097492..1098076
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGVLTSKTPPWLVVDVCGVGYELEVPMSTFCELPDVGYEVNLFTHYTQKDDSAAL
YGFLSESERRLFRHLQRVSGIGTKIALAILSSVSVDTFAGLIQAGDANALTVIPGVGKKT
AERMLVELRDRAADFNNGISTSGKLNLDTVSEAALALQQLGYKPAEAARMARDAGTESDD
VAIVIKKALQTVLR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgcttgcgaggggttttgactagcaaaacgccaccgtggctcgtggttgat
gtgtgtggagttggctacgaactagaggtgccgatgagcactttttgcgaattgccagac
gtcggttacgaggtgaatttgtttactcactatacgcagaaggatgatagtgccgcgttg
tacggttttctgagcgaaagtgagcggcggctattccgccacctgcagcgggtgagtggt
atcggtaccaagatcgctttggcgattctatccagcgtcagcgtggatacatttgcgggg
ttaatccaggctggtgacgctaatgcattaacggttatcccaggagttgggaagaaaacc
gctgaacgtatgctggtggagttgagagaccgtgctgcagacttcaacaatggtatttcc
acctcaggcaagctcaatcttgatacggtatctgaagctgccttggctttgcagcaactc
ggttataagccagctgaggctgcacgtatggcacgtgatgccggtactgagagcgatgat
gttgctattgtcatcaaaaaagcgcttcaaaccgtattacgttga

DBGET integrated database retrieval system