KEGG   Xylella fastidiosa Temecula1: PD0996Help
Entry
PD0996            CDS       T00113                                 

Gene name
lycV
Definition
phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xft  Xylella fastidiosa Temecula1
Brite
Enzymes [BR:xft01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PD0996 (lycV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1199380..1199991)
Genome map
AA seq 203 aa AA seqDB search
MLCPHRMIYSRPAHLSRAFFYSKPATAFGRFFAYWSPPMQTIGEEGIALIKFFEGCKLSP
YTCPGGVLTIGYGETGKHVVPGLRLTNEQEADARLRARLAKEFEPAVRRHVKVTLAQHQF
DALVSLSFNIGVGAFHRSTLLRKLNAGDVAGAAEQFHVWKWAGGRVQSGLVRRRKAERWL
FEGKDWQAALAAEHAAVKKASRD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgctatgtcctcatcgaatgatttactcgcgccctgcccacctcagcagggcttttttt
tattcaaagccagcgaccgccttcgggcggttttttgcgtactggagtccccccatgcag
accattggtgaagaaggcattgcactcatcaagttttttgagggttgtaagctgagtccg
tacacctgtcctggtggtgtgttgacgattggctatggtgagacgggcaagcacgtcgta
ccagggttgcggcttaccaatgagcaggaagcagatgcgcggttacgtgcacgcttagcg
aaagaatttgagccggcggtacggcgacatgtgaaggtgactttggcgcaacatcaattt
gatgcgctggtgtcgctgagcttcaacattggtgtgggcgcgtttcaccgctcgacgctg
ttacgcaagcttaatgccggtgatgtggctggtgcggcggagcagtttcatgtgtggaaa
tgggcgggcggtcgtgtgcagtctggtttagttcggcgtcgaaaagccgaacgttggcta
tttgaaggtaaagattggcaggccgcattagcagccgagcatgcggcggtgaagaaggca
tcacgtgattga

DBGET integrated database retrieval system