KEGG   Xylella fastidiosa Temecula1: PD1068Help
Entry
PD1068            CDS       T00113                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PD1068 (hemD)
Enzymes [BR:xft01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PD1068 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1270076..1270849
Genome map
AA seq 257 aa AA seqDB search
MTRPDQARTPWYLLSLRPANNHAALRRAVARYGGGLIALSPWRLKRLDSPETRSALASAL
TASTLVFTSPEAVRAAHALQTLRTSPGQVWLCVGASTARVLQQCGITRVLHPTQMNSEGL
LTLLAQQPPTEVGLITAPGGRDLLQQKLLENGIRLHRADVYERQPLRLRTATLDTLQRNA
TRSLLALSSAEALALLLPQWPDNLRRILYQRPVIATSKRLEDLACARGFISVYRATGPLP
RQLAATAAAFRPDKTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaccagaccaagcccgcaccccatggtatttgttgtcactacgtccggcaaac
aaccacgccgcactgcgccgtgccgtcgcgcgttacggaggaggattaatcgcactatcc
ccgtggcgattaaagcgtctagacagtccagagacacgctctgcattagcatcagcattg
acggcatcaaccctggttttcaccagtccagaggcagtacgtgcggcacatgctctgcaa
acgctacgcacttcacctggacaagtatggttgtgcgttggcgcaagcactgcacgcgtg
ctacaacagtgcggtattacacgcgtgttgcacccaacacaaatgaacagtgaagggtta
ctcacattactggcacagcaacccccaaccgaagttggacttattaccgcaccaggagga
cgtgatttactccagcagaagcttttagaaaatggcatacggttacatcgtgccgatgtc
tacgaacgtcaaccgttacgtctgcgcacagccacattggatacactccagcgtaatgcc
acacgtagcctgcttgcactgagcagtgccgaagctttagcactcttactgccacaatgg
ccggataacctgcgaaggatcctgtaccagcgtccagtgattgcaacaagcaaacggcta
gaagatctagcatgcgcgcgaggatttatcagcgtttatcgcgccacaggaccattgccg
cgccagttagcagcaacagcagcggcttttcgacccgataaaacagcacaatga

DBGET integrated database retrieval system