KEGG   Xylella fastidiosa Temecula1: PD1169Help
Entry
PD1169            CDS       T00113                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xft00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xft00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1372474..1373052)
Genome map
AA seq 192 aa AA seqDB search
MNMLNVLRFPVLALALAFVSSGVLADVGSLLDLDYRPLAGKETVNLQRLYGGKVLLVVNT
ASKCGFTPQYEGLEALHQKLSPLGFAVLGFPSNDFKGQEPGDEQQIQEFCTLTYGVKFPM
FQKVHVKGNEVTPLYQRLTQTTGVAPGWNFHKYLIARDGHVVAQFDSRTRPDDPILLEAI
KRELAKSVQVVH
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgctcaatgtgttgaggtttcccgttttggctttggctttggcttttgtttct
agtggtgtactggccgatgtggggagtttgctggatttggattaccgtccgttggccggt
aaagagactgtcaatttgcagcgcctttatggtggcaaggtgctgttggtggtcaatacc
gccagtaaatgtggttttaccccgcaatacgaaggattagaggcattgcaccagaaattg
tcgccacttggttttgctgtacttggttttccatccaacgactttaaggggcaagaacca
ggtgatgagcagcaaattcaggaattctgcacgctgacgtatggggttaagtttccaatg
tttcagaaggttcacgtcaaaggcaatgaggtcacgccactgtatcagcgcttgacgcag
acgacgggtgtggcaccgggctggaactttcacaagtacctcattgcgcgtgatggccat
gttgtggctcagtttgatagccgtacgcggcctgatgatccaattctgttggaagcgatc
aagcgtgagttggcaaagtcggtgcaggtagtgcactga

DBGET integrated database retrieval system