KEGG   Xylella fastidiosa Temecula1: PD1259Help
Entry
PD1259            CDS       T00113                                 

Definition
methionine salvage pathway enzyme
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PD1259
Enzymes [BR:xft01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PD1259
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PD1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1469270..1469836
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFDDHTPDTPFFVSKEQAQITAELHKIGITFERWEATQAIEPGATAEQVMAAYRT
DIDRLIATHGFKTVDVISIAPDNAKREEMRAKFLEEHFHKEDEVRFFVAGSGLFTVHSGN
KVYEIECVKNDLIAIPDGTLHWFDMGAAPYFVAIRFFTEPDGWVGHFTGTDIAQRFPRYI
PEGCQSAH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactacgcatcttcgacgatcacacccccgatacgccgttcttcgtcagcaaa
gagcaggcacagatcaccgccgagttgcacaagattggcatcacgttcgagcgctgggaa
gcgactcaagcgattgaacctggtgcaactgcagagcaggtcatggcggcctaccgtact
gacattgatcggctgatcgccacacatggtttcaaaaccgtagacgtgatcagcatcgct
ccagacaatgccaagcgcgaagagatgcgcgccaaatttcttgaggaacattttcacaag
gaagatgaggtccgtttcttcgttgctggctcgggattattcaccgtgcacagcggcaac
aaagtctatgaaatcgaatgcgttaaaaacgatctgatcgcaatacccgatggcaccctg
cactggtttgatatgggtgccgcgccctacttcgtcgctatccgcttttttaccgaaccg
gatggctgggttggccatttcaccggcactgacattgcacaacgcttcccccgctatatc
cccgagggctgccaaagcgcgcactga

DBGET integrated database retrieval system