KEGG   Xylella fastidiosa Temecula1: PD1259Help
Entry
PD1259            CDS       T00113                                 

Definition
methionine salvage pathway enzyme
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:xft00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1469270..1469836
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFDDHTPDTPFFVSKEQAQITAELHKIGITFERWEATQAIEPGATAEQVMAAYRT
DIDRLIATHGFKTVDVISIAPDNAKREEMRAKFLEEHFHKEDEVRFFVAGSGLFTVHSGN
KVYEIECVKNDLIAIPDGTLHWFDMGAAPYFVAIRFFTEPDGWVGHFTGTDIAQRFPRYI
PEGCQSAH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactacgcatcttcgacgatcacacccccgatacgccgttcttcgtcagcaaa
gagcaggcacagatcaccgccgagttgcacaagattggcatcacgttcgagcgctgggaa
gcgactcaagcgattgaacctggtgcaactgcagagcaggtcatggcggcctaccgtact
gacattgatcggctgatcgccacacatggtttcaaaaccgtagacgtgatcagcatcgct
ccagacaatgccaagcgcgaagagatgcgcgccaaatttcttgaggaacattttcacaag
gaagatgaggtccgtttcttcgttgctggctcgggattattcaccgtgcacagcggcaac
aaagtctatgaaatcgaatgcgttaaaaacgatctgatcgcaatacccgatggcaccctg
cactggtttgatatgggtgccgcgccctacttcgtcgctatccgcttttttaccgaaccg
gatggctgggttggccatttcaccggcactgacattgcacaacgcttcccccgctatatc
cccgagggctgccaaagcgcgcactga

DBGET integrated database retrieval system