KEGG   Xylella fastidiosa Temecula1: PD1304Help
Entry
PD1304            CDS       T00113                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xft00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1530398..1531897
Genome map
AA seq 499 aa AA seqDB search
MKKKYILAIDQGTTSSRAILFDHKGRIIGMAQREFTQIFPQPGWVEHNPRDIMTSVYTTI
TELLNNTQIDVRAIAGIGITNQRETTVIWDRQTGQPIYNAIVWQSRQTKDICDQLTTAGY
QDMVHAKTGLLIDAYFSGTKVKWILDHVENAHTQAARGELAFGTIDTWIIWNLTGGQVHV
TDYSNASRTLLYDIHALRWDPDLLTMLDIPAAILPDVRSSSEIYGLTQTPYFHGEQIPIA
GIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMHTGKKAVESQNGLLTTIAWGLNGEIEY
ALEGSIFIAGSVVQWLRDGLRMFGKASDSQAYADRVSDNGGVYVVPAFVGLGAPYWRSDV
RGAVFGLTRSTTKEHFVRAALESMAYQTRDVLSAMQADADIELKELRTDGAAITNDFMAQ
FQSDILAVPVLRSQIAETTALGAAYLAGLATGFWSSREEMTQHWAINRCFKPQMDKEQRE
HLYAGWKQAVEATLGFRVA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaatacatactggccattgaccaaggcaccaccagctcccgggccattctg
tttgaccacaaaggccgcatcatcgggatggcacagcgggaattcacccagatatttccc
caacctggctgggtcgaacacaacccgcgcgacatcatgaccagtgtgtacaccacgatc
accgaactgctcaacaacacccagattgacgtgcgcgccatcgccggaatcggtattacc
aaccaacgcgaaacaaccgtcatctgggatcgtcagaccggccaaccgatctacaacgca
atcgtttggcaatcacgccaaaccaaggacatctgcgaccaactcacgaccgccgggtac
caagatatggttcacgccaaaaccggactcctgatcgacgcctatttttcaggcaccaag
gtgaaatggattctggaccatgtcgaaaacgcacatacacaagcagcgcgcggagaactg
gcattcggcaccatcgacacctggatcatctggaacctgaccggcggccaagtccatgtc
accgattacagcaacgcctcacgcaccctgctgtacgacatccacgccctgcgttgggat
ccagacctgctgacaatgctagacataccagcggcgatcctgccggacgtccgttcatcc
agcgaaatttacggtctcacccaaaccccgtatttccacggagaacagataccgattgcc
ggaatcgccggcgatcagcaagccgcactcttcggccaagcctgtttcgaacctggcatg
gccaaaaacacctacggcaccggctgtttcatgctcatgcacaccggcaaaaaagccgtg
gaatcccaaaatggactactcactacgatcgcttggggcctgaatggagaaatcgagtac
gcactagaaggctcgatcttcatcgctggctctgtggtgcaatggctgcgcgatggatta
cgcatgttcggcaaagccagcgattcacaagcctacgccgaccgtgtcagcgacaacggc
ggcgtatacgttgtaccggccttcgttggcctgggtgcgccctactggcgtagcgatgtc
cgcggcgcagtgttcggactgacacgcagcaccaccaaagaacacttcgtccgcgccgca
ctagaatcaatggcctaccaaacccgcgacgtcctgagcgcaatgcaggcagatgcagac
atcgaactcaaagaactacgcactgacggcgcggccatcaccaacgacttcatggcccaa
ttccagagcgatatcctcgccgtgccagtgctgcgctcgcagatcgccgaaaccacagca
ctcggtgccgcctacctggctggacttgcgaccggattttggtccagccgcgaagagatg
acgcaacactgggcgatcaatcgctgcttcaagccacagatggataaggaacaacgcgag
cacctatacgcaggctggaaacaggccgtcgaagccacattaggtttccgtgtggcctga

DBGET integrated database retrieval system