KEGG   Xylella fastidiosa Temecula1: PD1450Help
Entry
PD1450            CDS       T00113                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PD1450 (gtaB)
   00052 Galactose metabolism
    PD1450 (gtaB)
   00500 Starch and sucrose metabolism
    PD1450 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    PD1450 (gtaB)
Enzymes [BR:xft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PD1450 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1690652..1691542)
Genome map
AA seq 296 aa AA seqDB search
MIKRIRKAVFPVAGLGTRFLPATKTIPKEMLPIIDKPLIQYAVDEAIQAGCDTLVFVTNR
YKHAVADYFDKAYELEQKLERAGKYEQLELVRHVLPDGVRTVFVTQTEALGLGHAVLCAK
PVVGDEPFAVLLPDDLMWSRNGGALKQMADVAEVSGSSVIAVEDVPVDKTVNYGIVGTDV
FDGCKGRITQIVEKPKPDDAPSNLAVVGRYVLSGKIFEMLENTSIGTGGEIQLTDAIAEL
LKYERVDAYRFQGRRFDCGAHIGLIEATLHLALEHKKHGQAVREILRDTLLTVDKR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcgtattcgcaaggctgttttccctgtggccggtcttggtacacgttttttg
ccagcgaccaaaaccatccccaaggaaatgctgccaattattgataaacccctcatccag
tacgcggttgacgaagcgatccaggctggatgcgatacccttgtgtttgtgaccaaccgt
tacaagcatgcggtggccgattacttcgacaaagcgtatgaattggagcagaagcttgag
cgtgccggtaaatatgagcagctggaattagtgcgtcatgtgttgcctgatggagtgcgt
acggttttcgtgactcaaactgaagcgctgggtctaggccatgcagtgttgtgcgccaag
cctgtggtgggtgatgaaccatttgcggtgttgctgccagacgatctcatgtggagtcgt
aatggaggtgcactgaaacaaatggctgatgttgctgaagtctccggtagcagtgtcatt
gcagtagaggatgtccccgtcgataaaaccgttaactatggcatcgtcggaacggatgtg
tttgatggatgcaagggccgcattactcaaatcgtcgaaaagcctaagcccgacgatgca
ccgagcaatcttgctgtggtggggcgctatgtcctgagtggcaagatattcgagatgctt
gaaaacacctctatcggtactggcggcgagattcaattgactgatgcgatcgctgaatta
ctgaaatacgagagagtggatgcataccgcttccaaggtcgccgatttgattgtggtgca
cacattggtctgattgaggctaccctgcatttagcccttgaacacaagaaacatggtcag
gcggtgcgtgagatcctgcgtgacacattacttacggtcgacaagagataa

DBGET integrated database retrieval system