KEGG   Xylella fastidiosa Temecula1: PD1698Help
Entry
PD1698            CDS       T00113                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PD1698 (rbsK)
Enzymes [BR:xft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PD1698 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975835..1976788
Genome map
AA seq 317 aa AA seqDB search
MHSVVVVGSFSIDHVWRCDTLPTPGATIAGRYSRGPGGKGFNQAVAACRAGARTYFICAL
GNDTDGNMARDIATKDGFTLIGESSTEPTGTGGIYVDSHGHNTIVTGAGANAVLSTHFIT
EQRALITSAWIVLAQLESPIETLETALSMAREAGRLTILNAAPANATATINLLKLADVLT
LNETEFVALLSRHVGERISPDNVATTDGNTLHALCNKLLSGSTVVITLGSAGVFVSHSEE
NLRGDTQPYYRVAAEQAHTVDTTGAGDAFNGALAASLARQPNTAFIQHIRLANSYAARST
ETEGGAVSMPILTTTQD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagtcgtcgtcgtcggctccttcagtattgatcatgtttggcgctgcgacaca
ttgcccacacctggtgcaacaattgccggccgctatagccgtggtccaggaggcaaaggc
ttcaaccaagccgtggcggcttgccgcgctggtgcgcgcacctatttcatatgcgcactc
ggcaatgacaccgacggcaatatggcacgcgacatcgccacaaaagacggcttcacactg
atcggcgaatccagcaccgaacccactggcaccggagggatctatgtcgacagccacggc
cataacactatcgtcactggcgctggtgccaacgcagtactgagcacccacttcatcaca
gaacaacgcgccctaattacctcagcatggatcgtcttggcacaactggaatcaccgata
gaaacactcgaaacggcgctcagcatggcgcgcgaagctggccgcttgaccatactcaat
gctgcccccgccaatgcaaccgccacgatcaacctactcaaattggccgacgtgctcaca
ctgaacgaaacggaattcgtcgccttgctcagccgtcacgtcggtgaaaggatcagtccc
gacaacgtcgccaccaccgatggcaacacactacacgccttatgcaacaaactactgtcc
ggcagtacggttgtcattacattaggctcggctggcgtattcgtttcacactcggaagaa
aacctgcgtggtgacacccagccctactatcgtgtggccgccgaacaggcccacaccgta
gacaccaccggagctggcgacgcatttaatggtgctttggcagcatccctggcacggcaa
ccaaacacagcgtttatccagcacatacgcctcgccaatagctatgcagcgcgctcgacc
gaaacagaaggtggagccgtatcaatgccaatattaacgactacccaagactaa

DBGET integrated database retrieval system