KEGG   Xylella fastidiosa Temecula1: PD1851Help
Entry
PD1851            CDS       T00113                                 

Gene name
engXCA
Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xft00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2170902..2172746
Genome map
AA seq 614 aa AA seqDB search
MSFSKHFGKLMLATCLSLSAAPAFSYSISHGKVVDDKGNQIQLRGVNWFGFETGDHVVNG
LWARNWKEFITQLQGMGFNAIRLPFCPANLNSNTSPSSIDYSRNPDLQGLSSLQILDKVV
KELSDRRMYVLLDHHRPDCSAISELWYTDSYSEKQWIDDLRFVAHRYANVHGVIGLEVKN
EPHGRTTWGTGDPKTDWNTAVEHAAAAILEAAPKWLIGVEGIGENPICSSTIGHFWGENL
EPMDCTPLKVPADHLLLMPHVYGPDVYVQPYFNSPDFPNNMAAIWDKHFGHFAKAGYAMA
IGEFGGKYGEGDPRDIAWQNAFVDYLISIGVTDAFYWAANQNSVDTGGMVGNDWTTPRDD
KVKLLNKLWNAGGGASGGSGGGAGASSGSGAGGGSSGGAGTGSGSGAGGGSSGGAGTGSG
SGAGGGSSGGAGASSGSGAGGGSSGGAGTGSGSGAGGGSSGGAGASSGSGAGGGSSGGAG
ASSGSGAGGGSSGGAGAGSGSGARGGSSGGAGAGSGSGAGGGSGSGSDPTKSKIAVNTIV
DSDWHTGYCERIQVTNTSDSPNTWTVTIPIKGKIQTLWSARWSVKDNALTAFGMDWNKTL
DPKGRTEFGFCSNY
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttccaaacacttcggcaaactcatgttggccacgtgcctatccttatctgcg
gcaccagcattcagttacagcatcagtcacgggaaggtcgtcgatgacaaaggcaaccaa
atccaattaaggggcgtcaactggtttggttttgaaaccggagatcatgtggtaaatgga
ctatgggcacgtaattggaaagaattcatcacacagctacagggcatgggattcaacgcg
atacgtttaccgttctgcccagccaatctaaatagcaacacatcaccaagcagcattgat
tacagccgcaatccggacttgcaaggcttgagctcgctgcaaatcctggacaaggtcgtc
aaagaattgagcgaccgcagaatgtatgtgctgctagatcaccatcggccggactgctca
gcaatctctgagttgtggtacacggattcatacagcgaaaaacagtggattgatgatcta
cgcttcgtcgcacaccgttacgccaacgtacacggcgtcatcggcttggaggtaaagaat
gaaccacatggcagaaccacctggggcaccggagatccaaaaactgattggaacaccgca
gtcgagcatgcggcagcagcgatcttggaggccgcaccaaaatggctgatcggagtcgag
gggattggagagaatcccatctgctccagcaccattgggcatttttggggcgaaaacctg
gaaccgatggactgtacgccactgaaagtccctgccgaccatttgctattgatgccacac
gtctacgggccagatgtctacgtacagccgtacttcaatagtccggatttcccaaacaac
atggcagcgatctgggataaacacttcggacattttgcgaaagccggctacgcgatggcg
attggtgagttcggtggcaagtacggtgaaggtgatccacgcgatatcgcttggcaaaac
gctttcgtggattacctcatcagtatcggcgtgacggatgccttctattgggcagcaaac
cagaacagcgtcgataccggcggcatggttggcaatgactggaccaccccacgcgatgac
aaggtgaagctgctgaataagctgtggaatgccggtggtggtgccagtggtggttccggc
ggcggtgctggtgctagttccggcagtggtgctggcggcggctccagcggcggtgctggt
actggttccggcagtggtgctggcggcggctccagcggcggtgctggtactggttccggc
agtggtgctggcggcggctccagcggcggtgctggtgctagttccggcagtggtgctggt
ggcggctccagcggcggtgctggtactggttccggcagtggtgctggcggcggctccagc
ggcggtgctggtgctagttccggcagtggtgctggcggcggctccagcggcggtgctggt
gctagttccggcagtggtgctggcggcggctccagcggcggtgctggtgctggttccggc
agtggtgctcgcggcggctccagcggcggtgctggtgctggttccggcagtggtgctggc
ggcggctccggtagcggctccgatcctacaaagagcaagattgctgttaataccatcgta
gacagcgattggcatactggttactgcgagcggatccaagtgacgaataccagcgacagt
ccgaatacctggacggtgacgattccaatcaaggggaagatccagacgctatggagcgcg
cgttggtcagtgaaggataacgcactcaccgcttttggtatggactggaataagacgctt
gatccgaaaggcaggactgaattcgggttctgttcgaactattga

DBGET integrated database retrieval system