KEGG   Xylella fastidiosa Temecula1: PD1963Help
Entry
PD1963            CDS       T00113                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xft  Xylella fastidiosa Temecula1
Brite
Enzymes [BR:xft01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PD1963 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2307676..2308332
Genome map
AA seq 218 aa AA seqDB search
MTIDFSIAREKMVEQQIRPWDVVDLHVLDVLAHIPREAFVPEPYRTLAYADLEIPLPGGQ
TMMKPVIEGRLLQALMLSPEEDVLEIGTGSGFLTACLASLGHEVVSLEINSALAASARTH
LDTIGLGSNVHIEQADAFTWQPERQFSVICLTGAVSTLPLQFLQWLHPNGRMFAIHGHSP
AMQAVLVRGDASTPNITSLFETDLAYLKGGEPALQFHF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgatttttccatagcccgcgaaaaaatggtcgaacagcagatccgtccatgg
gatgtggtggatctgcacgtacttgatgtactggcacacatcccacgcgaggcgttcgtc
cctgaaccataccgtaccctagcctacgcagaccttgaaatccccttacccggcggacaa
acaatgatgaaacccgtcattgaggggcgcctacttcaagccctgatgttgtcaccagaa
gaggacgtattggaaatcggcaccggcagtggtttcctcactgcctgcttggcttcactg
ggacacgaagtagtcagcctagagatcaattccgcactggccgcatcggcacgtacccac
ctagataccattggcctaggcagtaacgtacacattgagcaggccgacgctttcacttgg
caacccgaacgtcagttcagcgtcatttgcttgactggtgcagtgagcacgctgccactg
caatttctgcaatggctacaccccaacggccgtatgttcgctatacacggccactcccca
gcgatgcaagctgttctggtgcgtggagatgcctctaccccaaacatcacatccctgttt
gagaccgatctggcttacctcaaaggtggcgagccagccctccaatttcatttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system