KEGG   Xylella fastidiosa Temecula1: PD2061Help
Entry
PD2061            CDS       T00113                                 

Gene name
egl
Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xft00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PD2061 (egl)
Enzymes [BR:xft01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PD2061 (egl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2432506..2433576
Genome map
AA seq 356 aa AA seqDB search
MPISFLYPLCLLPSCFLILLTSLTTLAPTSPSHTTNILTYAGINLPGPEFSPSNKPGVLY
KDYLYPSASDYAYVAKKGMNIVRLPVLWERVQPTLNDALDATQLNLILNAVEQAKAQKLH
IILDIHNYAKYNDELIGSDNVPISAFADLWKRLSLQFSNDKAVIFGLMNEPHEITSTTWA
KAAQAAINAIRSTGARNLVLVPGTAYSGAHSWLSSYYGIPNGEALLNINDPAKHMAFEVH
QYLNENSTGTTGECISTTIGAEKLEAFTNWLRTYHKTGFLGEFATGNNDTCNQALEGMLS
YIEENADVWLGLTWWGSNPWFSPNYPFNLHPNSDGNDKPQMSILESHTRKITKIHK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcccatttcctttctataccctttatgcctcctcccctcctgtttcctaatactgctc
acaagcttgacgacactggcaccaacatcaccaagccataccacaaacatactgacgtac
gctggtatcaatcttcctggcccggaattcagcccaagcaataaaccaggtgttctctat
aaggactatctttatccaagtgcatctgactacgcttacgtggccaaaaagggcatgaac
atcgtgcgcctccctgtcctttgggaacgcgttcagcccacactgaatgatgcattggac
gccacgcaactcaacctgattcttaacgccgtcgagcaagcgaaagcacagaaattacat
atcattctagatatccataactacgccaaatataacgatgagctgatcggcagtgacaat
gttcctatcagcgccttcgccgatctatggaagcgtctgtccctacagttttccaacgac
aaagcagtcatcttcgggctgatgaacgagcctcatgaaatcacctcaaccacttgggct
aaggctgctcaagcagccatcaacgcaatccgcagcactggcgcacgtaaccttgtatta
gtgccgggtaccgcttacagcggcgcacacagttggctgagcagctactacggcatccct
aatggagaagcgctgctgaacatcaatgatcctgccaaacacatggcgttcgaagtacac
caatatctcaatgaaaatagcaccggcacgacgggcgaatgcatcagcaccaccatcgga
gccgagaagctagaagcattcaccaactggctgcgcacctaccataaaaccggtttcctt
ggcgagttcgctactggcaacaacgatacttgcaaccaagcattggaaggcatgctcagc
tatattgaggaaaacgcagacgtctggttgggactgacgtggtggggatctaacccctgg
tttagtcccaattatccattcaacctgcatccaaacagtgacggcaacgacaagccgcag
atgagcatcctggaatcacacacacgtaagatcactaaaatccacaaataa

DBGET integrated database retrieval system