KEGG   Xanthomonas fuscans: XFF4834R_chr08120Help
Entry
XFF4834R_chr08120 CDS       T03094                                 

Gene name
ppc
Definition
probable phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xfu  Xanthomonas fuscans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XFF4834R_chr08120 (ppc)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XFF4834R_chr08120 (ppc)
  Energy metabolism
   00680 Methane metabolism
    XFF4834R_chr08120 (ppc)
Enzymes [BR:xfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XFF4834R_chr08120 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940450..943164
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLAGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERASDAARFRMALTASWQTADSSPVRPTVDDEREHVGFYLTQVLYRVVPVMYETLEHA
IEETYGSVPALPRLLRFGTWVGGDMDGNPNVDATTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSGELTAQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDNA
DGAYAAPSELEHDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALDQTDWDAQDAAQRAAVLGPYAAGQDPLPRVEDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDDAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAAELGVRLT
FFHGCGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREARWRPVMDLVAERSTVAYRAFVGAPEFMQYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDTLREMA
QDWPFFRTFLDDIAMVLSKGDLNIAELFSRLSGDLHTRFFPLIGDELALTKGWVKALLQQ
RSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDQALLRALVACVNGVSQGV
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgctacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggtgcactggtgggtgatctactcgccgagcaggtctctgcggaattc
ctcgatgaaatcgaacgcgtgcgcaccaccgccatttcgcggcgtgaaagcgatgccccg
ccgtccacgttgagcgagcaattggccggacgcgagccgcgcgacgccgaagcgctggtc
cgggcattcagtacgtatttccaggtggtcaatatcgccgagcgcgtgcaccgcatccgc
cgccgtcgcgaataccagcgtagcggcaccgacacgccgcagcccgatggcctgcacgac
gcattgcgccggctcaaggcgcagggcgtgaccctggacgaactcagccaatggttgccg
cgcatcgacgtggagccggtgttcaccgcgcatcccaccgaggcggtacggcgcgcgctg
ctggagaaagagcagctgatggtcgccagcctggtcgacaacctggacggcatgcgcacg
cccaacgaacgcgccagcgatgccgcgcgctttcgcatggccctgaccgcgtcgtggcag
accgccgattcctcgccggtgcgcccgaccgtggacgacgagcgcgagcatgtgggcttc
tacctcacccaggtgctctaccgcgtcgtcccggtgatgtacgaaacgctcgaacacgcc
atcgaagaaacctacggtagcgtgccggcattgccgcgcctgctgcgcttcggcacctgg
gtgggcggcgacatggacggcaatcccaacgtggatgccaccaccatcgccgggacgctg
gacgcgcagcggcgcgcggtgctggaccgctatcaaaaagaactctggcagttggccagc
ctgctcagccaatcgaccacgctggtgcaggtgagcggcgaactcaccgcgcagctggaa
cgctaccgcgcgttgctccccgacgccgccgcgcgttcgcgcccgcgccatggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcgcgcctgcaggccaccctggacaatgcc
gatggtgcctatgccgctccatcggagctcgaacacgatctgcagctgatcctggacagc
ctgcaggccaacaagggcctgcatgccgggtggttcgcggtacgacgcctgttgtggcgc
gtgcgcagctttggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcagtggccgatgccctggaccagaccgactgggacgcacaggacgccgcccag
cgcgccgccgtgctcggcccgtatgccgcagggcaagaccccttgccgcgcgtggaagat
gaaggcaatgcacggttggatgcggtattcgccgcgcttgccgatgcacgtacgcgccac
ggcgccgatgcattgggcagctacatcatctcgatggcgcataaccgcgccgacgtcttg
accgtgctggcactggcgcgtcgtggcggcctggtcgacgacgccggcgctgtgccgctg
gatatcgtgccgctgttcgaaaccgtggacgatctgcgtggtggcaccggcaccgtgcag
gacctgctggccgatccggtctatcgccagcatctggccgcgcgcggcgatacccagatg
gtgatgctgggctactcggacagcggcaaggacggcggcatcgccgcctcgcgctggggt
ctgcaacgcgcgcaggtcgagctgctggaagcggccgccgagctgggcgtacggctgacc
ttcttccacggctgtggcggctcgatcgcgcgcggcggcggcaagaccagccgcgcgctg
gatgccgcaccgcgcggcagcgtggatggacgcttgcgcgtcaccgagcagggcgaggtg
atccaccgcaaatatggcattcgcgcattggcgttgcgctcgctggagcagatgaccggc
gcggtgctgctctcgagcctgcgcccgcgtgcgcccgagccgcgggaggcgcgttggcgc
ccggtgatggatctggtggccgaacgcagcacggtcgcgtatcgcgccttcgttggcgcg
ccggagttcatgcagtacttccgcctggccacgccgatcgatgtgatcgaacgcatgacg
ctgggttcgcgcccgtcgcggcggctgggccaggacgcggcgctgtccaacctgcgtgcg
attccatgggtatttgcgtggagccaggcgcgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagataccttgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgacatcgccatggtcttgtccaagggc
gatctgaacatcgccgagctgttctcgcgcttgtccggcgacctgcacacgcggtttttc
ccgctgattggcgacgaactggcattgaccaagggctgggtgaaggcgctgctgcaacaa
cgatcgctgttgcagcacgacccgcggctggcgttgtcgatccgcctgcgcaatccctac
atcgacccgatcagcgtgctgcaggtggatctgctgcaacgctggcgcgccaccgatggc
gaagaccaagcgctgctgcgtgcgctggtggcctgcgtcaatggcgtctcgcaaggcgtg
cagaacaccggctga

DBGET integrated database retrieval system