KEGG   Xanthomonas fuscans: XFF4834R_chr18730Help
Entry
XFF4834R_chr18730 CDS       T03094                                 

Definition
putative alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
xfu  Xanthomonas fuscans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XFF4834R_chr18730
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    XFF4834R_chr18730
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XFF4834R_chr18730
Enzymes [BR:xfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     XFF4834R_chr18730
Exosome [BR:xfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XFF4834R_chr18730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2144178..2145884)
Genome map
AA seq 568 aa AA seqDB search
MPMRYRLPTLAALTTLCVAACASTTGSGTSAPASVRVEVPQVTHPAGETPQWWYRSGAAR
AAGNGAMAGKARNVILFLGDGMSLTTVAAARILDGQRKGGPGEENLLSWEQFPATAFSKT
YNTDSQTPDSAGTMTSITTGVKSHMGAIGVSSGNRSDCADSLNKGLLSWLQLADSAGMAT
GIVTTTRLTHATPAATYAHSPDRNWENDTDLPESARAAGCQDIAQQLLSTARYGRGPQVV
LGGGRSQFQSVQERDPEYDDKVGLRLDGRDLVAEWKQAHPQGAYVWSEQQLQAASGAPAL
LGLFEPDHMQFDHDRNRTPQGEPSLTEMTRTAVQSLSRDPNGFVLMVEGGRIDHANHAGN
AYRALDETVSLSDAVRVAVQTAPPDTLIIVTADHSHTLNFVGYPVRGNPILGKVRGTGGE
EGDRSQLATDLAGQPYTTLSYANGPGYTGASNAQPAGPKKYPHEPSSSEPATGRPDLSHV
DTEAPSYMQEALVPTKSESHGGEDVGIWATGPGSAAFRGTLEENVIYHVIVQATPRLRER
LCKAGTCNAAGVPVELPKPATFEAAVKR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgcgttaccgcctgcctaccctcgccgccctgaccacgctgtgcgtcgccgcc
tgcgcctccacgaccgggagcggcacctccgcacccgcgtcggtccgcgtggaggtgccg
caggtgacgcacccggccggcgaaaccccgcaatggtggtaccgctcgggcgccgcccgt
gccgccggcaacggcgccatggccggcaaggcgcgcaacgtgatcctgttcctgggcgat
ggcatgagcctgaccacggtggccgcggcgcgcatcctggacggccagcgcaagggcggc
ccgggcgaagagaacctgctgtcttgggagcagtttcccgccaccgctttcagcaagacc
tacaacaccgactcgcagacaccggattcggccggcaccatgacctccatcaccaccggc
gtgaagtcgcacatgggcgcgatcggggtcagcagcggcaaccgcagcgactgcgccgac
agcttgaacaagggcctgctgagctggctgcagctggccgacagcgccggcatggccacc
ggcatcgtcaccaccacgcgcctgacccacgccacgccggcggcaacctatgcgcattcg
ccggaccgcaactgggaaaacgacactgacctacccgagtcggcgcgtgctgccggttgc
caggacattgcccagcaattgctctccaccgcccgctacggccgaggcccgcaggtggtg
ctgggcggaggacgcagccagttccagagcgtgcaggagcgcgacccggaatacgacgac
aaggtgggcctgcgcctggacggtcgcgatctggtggccgaatggaaacaagcgcacccg
cagggcgcctatgtctggagcgagcagcaattgcaggcagcgtccggtgcaccggcgctg
ctggggctgttcgaaccggaccacatgcagttcgatcacgaccgcaaccgcaccccgcag
ggcgaacccagcctgaccgagatgacccgcaccgcggtccagtcgctgtcgcgcgacccg
aacgggttcgtgctgatggtcgaaggcggccgtatcgatcacgccaaccacgccggcaac
gcctaccgcgcgctcgatgaaaccgtgtcgctgtccgatgccgtgcgcgttgctgtgcag
actgcgccaccggacacgctgatcatcgtcaccgccgaccattcgcacacgctcaacttc
gtcggctacccggtgcgcggtaacccgatcctgggcaaggtgcgcggcaccggcggcgaa
gaaggcgaccgcagccagctggccaccgacctggccggccagccgtacaccacgctcagc
tacgccaatggccccggctacaccggtgccagcaacgcgcagccggccggccccaagaag
tatccgcacgaacccagcagcagcgagccggccactggccgcccggacctgagccatgtc
gacaccgaagcccccagctacatgcaggaagcgctggtgccgaccaaatccgaaagccac
ggcggcgaagatgtcggcatctgggccaccggccccggcagcgcggcattccgcggcacg
ctggaagagaacgtgatctaccacgtcatcgtccaggccactccgcgcctgcgcgagcgc
ctgtgcaaggccggcacctgcaatgccgctggcgtgccggtggaattgcccaagccggcc
acgttcgaggctgcggtcaagcgctga

DBGET integrated database retrieval system