KEGG   Xanthomonas fuscans: XFF4834R_chr40370Help
Entry
XFF4834R_chr40370 CDS       T03094                                 

Definition
putative metallophosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xfu  Xanthomonas fuscans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XFF4834R_chr40370
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    XFF4834R_chr40370
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XFF4834R_chr40370
Enzymes [BR:xfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     XFF4834R_chr40370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4668189..4669760
Genome map
AA seq 523 aa AA seqDB search
MTASDPARRRVLQGLGAGFLLPATAGWSTRSLAAPSGRPIITDGVQSGDVLDDRAMLWSR
ADRPARLRVEWDTRPSLRQARRVDGTTASAAQDFTARADLSGLPRDQDIFYRVRFEDADS
GVLSAPVHGHLRSAPQARGDVRFVWSGDTVGQGFGINPDIGGMRIYSAMRERNPDFFLHS
GDTIYADGPIPAELRVEEGKRWRNLTTAAKSKVAETLDEFRGNYRYNLLDEHVRRFNAEV
PQLWQWDDHETTNNWSPGKQLDARYQVRDIDVLARRARQAFLEYAPMRGVRADGNGRIYR
RIAYGPLLDVFVLDMRSDRGANSDNLQPQPGPDAAFLGPEQLAWLQRELAGSRAQWKVIA
ADMPIGLQVPDGEDANGRPRWEAIANGDPGVPRGREQEIAMLLCFISRARIRNTVWLTAD
VHYCAAHYYHPDRAAFQQFEPFWEFVGGPLNAGSFGPNALDATFGPSVVFQKAPPAPNTS
PLAGYQFFGEVEIDGRSGVLTVTLRDLDGVAQFRQPILPHGVA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctccgatcccgcccgtcgccgcgtcctgcaaggcttgggcgccggtttcttg
ctgccggccactgccggttggtccacgcgcagcctggccgcgccgtcggggcgaccaatc
atcaccgacggtgtgcagagcggcgatgtgctggacgaccgcgcgatgctgtggagccgt
gccgatcgcccggcgcggttgcgggtggaatgggacacgcgtccaagcctgcgtcaggcg
cggcgcgtggacggcacgaccgcgtcggcggcgcaagacttcaccgcacgcgcggacctg
agcggtctgccgcgcgatcaggacatcttctatcgcgtgcgcttcgaagatgccgacagc
ggcgtgttgagcgcgcccgtccacggccacctgcgcagtgcgccgcaggcacgtggcgat
gtgcgctttgtctggagcggcgacaccgtcggccagggcttcggcatcaacccggacatc
ggcggcatgcgtatctacagcgcgatgcgcgagcgcaatccggatttcttcctgcacagc
ggcgataccatctacgccgacggcccgatcccggccgagctgagggtggaagagggcaag
cgctggcgtaacctcaccaccgcggccaagagcaaggtggccgaaacgctggacgaattt
cgcggcaactatcgttacaacctgctcgacgagcatgtgcgccgcttcaacgccgaggtg
ccgcaactctggcaatgggacgaccacgaaaccaccaacaactggtcgcccggcaagcaa
ctggatgcgcgctatcaggtgcgcgacatcgacgtgctggccaggcgcgcccgccaggcc
tttctggaatatgcgccgatgcgcggcgtgcgcgccgatggcaacgggcgcatctaccgc
aggattgcctacggccccttgctggatgtgttcgtgctggacatgcgcagtgaccgcggc
gccaacagcgacaacctgcaaccgcagcccggccccgatgccgcgtttctcgggccggag
caattggcgtggttgcaacgcgaactggccggctcgcgcgcgcaatggaaggtgattgcc
gccgacatgccgatcggcctgcaggtgcccgatggcgaagatgcgaacgggcgcccgcgc
tgggaagcgatcgccaatggcgaccccggcgtgccgcgtggccgcgaacaggaaatcgcc
atgctgttgtgcttcatcagccgcgcacgcatccgcaatacggtgtggctcaccgccgac
gtgcattactgcgcggcgcactactaccaccccgatcgcgcagcgtttcagcagttcgaa
ccgttttgggaatttgtcggcggcccgctcaatgccggcagtttcgggcccaatgcactg
gatgccacgttcggcccgagcgtggtgtttcaaaaagcgccacctgcgcccaacacctcg
ccgctggccggttaccagttctttggcgaagtggaaatcgacggccgcagcggcgtgctc
acggtgacgctgcgcgacctggatggggtggcgcagttccgtcaaccgattctgccgcac
ggcgtggcgtag

DBGET integrated database retrieval system