KEGG   Xenopus laevis (African clawed frog): 100036770Help
Entry
100036770         CDS       T01010                                 

Gene name
cyp2a6
Definition
cytochrome P450, family 2, subfamily A, polypeptide 6
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Retinol metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100036770 (cyp2a6)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100036770 (cyp2a6)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP2 family
   100036770 (cyp2a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 494 aa AA seqDB search
MDTSWLWTLLLSLLISCILIYSTWNKMYRKRNLPPGPTPIPLFGNVLQIKRGEMVKSLIE
YGKKYGDTYTLYFGPSPVIILCSYRATKEALIDQAEDFSGRGAMPSFDQYFQGYGVVFTN
GEEWKQLRRFSLTTLRNFGMGKRGIEERIQEEAQFVVEEIKSYKKKPFDPTDILVQCVSN
VICSVVFGNRFEYDNKDFQNLLSLFQSVFRESSSAWGQLLNMFPLIMNHIPGPHKKVIRD
MNKLEAFVLQRVKENEKTLDSNSPRDIIDSFLIKMQQENENPTSAFHMKNLLATVLSIFF
AGTETVSTTLRHGFLILLIYPEIEAKLREEIDRVIGQNRSPTIEDRSKMPYTDAVIHEIQ
RFSDVIPMNVPHLVTKDTQFRGYTIPKGTDVYPLLCAVLRDPEKFATPYEFNPNHFLDDN
GCFKSNDGFMPFSTGKRICLGEGLARMELFLFLTNILQHFKLHTESRLIEDDIAPKMNGF
ANYPTSYQLSFIPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggacacatcatggctgtggactctgctactgtctctgctgatctcctgcatattaatc
tattctacctggaataaaatgtacagaaagcggaatctccctccaggacccactcctatc
cctctgtttggaaatgttctgcagatcaagaggggagagatggtaaaatcattaattgag
tatggaaaaaaatatggtgatacctacactctttactttggccccagtcccgtcatcatt
ttgtgcagttatcgggcaacaaaagaggctcttattgaccaggcagaagattttagtggt
cgtggtgcaatgccaagttttgatcaatattttcaaggatacggtgtagtatttactaat
ggagaagaatggaagcagctcagacgcttttcccttacaacactaaggaacttcggtatg
ggaaagagaggcattgaagaaaggatacaagaagaagcacagttcgtggtggaagagatt
aagtcatacaaaaagaaaccttttgatccaaccgatatcttagtccaatgtgtgtccaat
gttatctgctcggttgtttttgggaatcgtttcgaatatgacaacaaggattttcagaat
ctcctttccctgtttcaatctgtattccgagaatcaagctccgcctggggtcagttgttg
aatatgttcccactcatcatgaaccacatcccaggtcctcataaaaaagttataagggac
atgaacaagctggaagcttttgttttacaaagagtgaaagagaatgaaaagactttggat
tccaactcaccaagagacatcatcgacagctttctcataaaaatgcagcaggaaaatgaa
aatcccacttctgccttccatatgaagaatttactagctactgttttgagcatatttttt
gccgggacagagacagttagcaccaccctaagacacggatttctcatacttctcatatat
cctgaaatagaagcaaaacttcgagaggaaattgacagagttattggtcaaaaccgcagc
cctaccattgaggacaggagcaagatgccttacacagatgctgtaatccatgagatccaa
agatttagtgatgtaatccctatgaatgtcccacatttagtcacaaaagacacacaattc
agaggatacactattcccaagggtactgatgtctaccccttgctttgtgctgttctacgg
gatcctgagaaatttgccactccatacgaatttaatccaaatcactttttagatgacaat
ggctgttttaagagtaatgatggcttcatgcctttttccacagggaagcggatctgcctt
ggggaaggtttggctcgaatggaactctttctcttcctaaccaacattctacagcacttc
aagttgcatacagaatctcggttgatagaagatgacattgccccaaaaatgaacggtttt
gcgaattacccaacgtcttaccaactttcgtttattccacgttga

DBGET integrated database retrieval system