KEGG   Xenopus laevis (African clawed frog): 100036770Help
Entry
100036770         CDS       T01010                                 

Gene name
cyp2a6
Definition
cytochrome P450, family 2, subfamily A, polypeptide 6
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Retinol metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xla00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 494 aa AA seqDB search
MDTSWLWTLLLSLLISCILIYSTWNKMYRKRNLPPGPTPIPLFGNVLQIKRGEMVKSLIE
YGKKYGDTYTLYFGPSPVIILCSYRATKEALIDQAEDFSGRGAMPSFDQYFQGYGVVFTN
GEEWKQLRRFSLTTLRNFGMGKRGIEERIQEEAQFVVEEIKSYKKKPFDPTDILVQCVSN
VICSVVFGNRFEYDNKDFQNLLSLFQSVFRESSSAWGQLLNMFPLIMNHIPGPHKKVIRD
MNKLEAFVLQRVKENEKTLDSNSPRDIIDSFLIKMQQENENPTSAFHMKNLLATVLSIFF
AGTETVSTTLRHGFLILLIYPEIEAKLREEIDRVIGQNRSPTIEDRSKMPYTDAVIHEIQ
RFSDVIPMNVPHLVTKDTQFRGYTIPKGTDVYPLLCAVLRDPEKFATPYEFNPNHFLDDN
GCFKSNDGFMPFSTGKRICLGEGLARMELFLFLTNILQHFKLHTESRLIEDDIAPKMNGF
ANYPTSYQLSFIPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggacacatcatggctgtggactctgctactgtctctgctgatctcctgcatattaatc
tattctacctggaataaaatgtacagaaagcggaatctccctccaggacccactcctatc
cctctgtttggaaatgttctgcagatcaagaggggagagatggtaaaatcattaattgag
tatggaaaaaaatatggtgatacctacactctttactttggccccagtcccgtcatcatt
ttgtgcagttatcgggcaacaaaagaggctcttattgaccaggcagaagattttagtggt
cgtggtgcaatgccaagttttgatcaatattttcaaggatacggtgtagtatttactaat
ggagaagaatggaagcagctcagacgcttttcccttacaacactaaggaacttcggtatg
ggaaagagaggcattgaagaaaggatacaagaagaagcacagttcgtggtggaagagatt
aagtcatacaaaaagaaaccttttgatccaaccgatatcttagtccaatgtgtgtccaat
gttatctgctcggttgtttttgggaatcgtttcgaatatgacaacaaggattttcagaat
ctcctttccctgtttcaatctgtattccgagaatcaagctccgcctggggtcagttgttg
aatatgttcccactcatcatgaaccacatcccaggtcctcataaaaaagttataagggac
atgaacaagctggaagcttttgttttacaaagagtgaaagagaatgaaaagactttggat
tccaactcaccaagagacatcatcgacagctttctcataaaaatgcagcaggaaaatgaa
aatcccacttctgccttccatatgaagaatttactagctactgttttgagcatatttttt
gccgggacagagacagttagcaccaccctaagacacggatttctcatacttctcatatat
cctgaaatagaagcaaaacttcgagaggaaattgacagagttattggtcaaaaccgcagc
cctaccattgaggacaggagcaagatgccttacacagatgctgtaatccatgagatccaa
agatttagtgatgtaatccctatgaatgtcccacatttagtcacaaaagacacacaattc
agaggatacactattcccaagggtactgatgtctaccccttgctttgtgctgttctacgg
gatcctgagaaatttgccactccatacgaatttaatccaaatcactttttagatgacaat
ggctgttttaagagtaatgatggcttcatgcctttttccacagggaagcggatctgcctt
ggggaaggtttggctcgaatggaactctttctcttcctaaccaacattctacagcacttc
aagttgcatacagaatctcggttgatagaagatgacattgccccaaaaatgaacggtttt
gcgaattacccaacgtcttaccaactttcgtttattccacgttga

DBGET integrated database retrieval system