KEGG   Xenopus laevis (African clawed frog): 100036771Help
Entry
100036771         CDS       T01010                                 

Gene name
cyp4b1.2
Definition
cytochrome P450, family 4, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 496 aa AA seqDB search
MASGLWKVLSSSWLPVNVAQIGQFAILLCVVLLVLKACALYSRGRKFTAALTPFPGPPSH
WLYGHVNQFRRDGKDLDRLMVWAKKYPNAFPLWIGKFFGTLIITHPEYAKLVFGRPDPKT
STGYSFLIPWIGKGLLVLSGDTWFQHRRLITPGFHYDVLKPYVGLISDSTKIMLDKLDAF
SNKDEPVELFQHVSLMTLDSIMKCAFSYQSNCQTDIDNDYIQAVYDLSWLTQQRIRTFPY
HSNLIYYLSPHGFRFRKACRIAHLHTDKVIGQRKKLLESKEELEKVQKKRHLDFLDILLC
AKDENGQRLSDEDIRAEVDTFMFEGHDTTSSGISWILHCMATHPEHQQKCQEEINEVLGE
RQTMEWDDLNRIPYTTMCIKESLRLYPPVPSVSRELAKPITFHDGKSLPAGILIFDPLRF
SPENSSKRHSHAFVPFAAGPRNCIGQNFAMNEMKVAVALTLKRFELLPDLSKPPLKLPQL
VLRSKNGIHVYLKKAS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggtctatggaaagtactgagtagctcctggctgcctgtgaatgtcgcccag
attggccagtttgcaatattactgtgcgtggtgctgcttgtgctgaaagcctgtgcgctt
tacagcagggggaggaagtttaccgcagctctaacgcctttccccggacctccctcccat
tggctctatggacatgtcaatcagtttcgtcgtgatggaaaagatctggatagattaatg
gtgtgggcgaaaaaatatccaaatgcctttccactgtggattggaaaattctttggcact
ctaatcatcactcacccagaatatgcaaagcttgtatttggaagaccagatcccaaaaca
tctactggatacagctttttgattccatggattgggaaagggctgctggttctttctggg
gatacttggtttcagcatcgaagactgatcacccctgggtttcactacgatgttctcaaa
ccttatgtcggtctcatttccgattccacaaaaatcatgctggataaactagatgccttt
tcaaataaggatgaacctgtggagctattccaacatgtcagcctgatgacactggacagt
atcatgaaatgtgcctttagttaccaaagcaactgtcagactgacatagataatgactac
attcaagctgtgtatgacctgtcctggttgactcagcagcgcattcgcacctttccttat
cacagtaacctaatttactatctgagccctcatggtttccgttttcgcaaagcctgcaga
atagcgcatctccacactgataaagtaatcgggcagaggaaaaagctcttggaaagcaag
gaagagttggagaaggtccaaaagaagaggcacttggattttctagacattctcctctgt
gccaaggatgaaaatgggcagaggctttctgatgaggatatacgcgctgaggtggacaca
ttcatgtttgagggacatgatactacatctagtggaatatcctggatcctacattgtatg
gctacacatccagagcaccagcagaaatgccaggaggagatcaatgaagtcttgggggag
cgacaaaccatggaatgggatgaccttaataggataccttataccacaatgtgtattaag
gaaagtctgcgcctataccctccagtcccatcagtatccagggagcttgccaaaccaata
acattccatgatgggaagtcattaccagcaggcattttgatatttgatcctcttcgattt
tctccagaaaattcttctaagcggcattcccatgcatttgtgccttttgctgcaggacca
aggaactgcattggacagaactttgctatgaatgagatgaaagtggctgtggcactgaca
ctgaaacgctttgagttgttaccagatctttccaagcctcccctcaagctgccacaactt
gttctgcgctccaaaaatggtatccacgtgtatctgaaaaaagcaagctga

DBGET integrated database retrieval system