KEGG   Xenopus laevis (African clawed frog): 100036771Help
Entry
100036771         CDS       T01010                                 

Gene name
cyp4b1.2
Definition
cytochrome P450, family 4, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100036771 (cyp4b1.2)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP4 family
   100036771 (cyp4b1.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 496 aa AA seqDB search
MASGLWKVLSSSWLPVNVAQIGQFAILLCVVLLVLKACALYSRGRKFTAALTPFPGPPSH
WLYGHVNQFRRDGKDLDRLMVWAKKYPNAFPLWIGKFFGTLIITHPEYAKLVFGRPDPKT
STGYSFLIPWIGKGLLVLSGDTWFQHRRLITPGFHYDVLKPYVGLISDSTKIMLDKLDAF
SNKDEPVELFQHVSLMTLDSIMKCAFSYQSNCQTDIDNDYIQAVYDLSWLTQQRIRTFPY
HSNLIYYLSPHGFRFRKACRIAHLHTDKVIGQRKKLLESKEELEKVQKKRHLDFLDILLC
AKDENGQRLSDEDIRAEVDTFMFEGHDTTSSGISWILHCMATHPEHQQKCQEEINEVLGE
RQTMEWDDLNRIPYTTMCIKESLRLYPPVPSVSRELAKPITFHDGKSLPAGILIFDPLRF
SPENSSKRHSHAFVPFAAGPRNCIGQNFAMNEMKVAVALTLKRFELLPDLSKPPLKLPQL
VLRSKNGIHVYLKKAS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggtctatggaaagtactgagtagctcctggctgcctgtgaatgtcgcccag
attggccagtttgcaatattactgtgcgtggtgctgcttgtgctgaaagcctgtgcgctt
tacagcagggggaggaagtttaccgcagctctaacgcctttccccggacctccctcccat
tggctctatggacatgtcaatcagtttcgtcgtgatggaaaagatctggatagattaatg
gtgtgggcgaaaaaatatccaaatgcctttccactgtggattggaaaattctttggcact
ctaatcatcactcacccagaatatgcaaagcttgtatttggaagaccagatcccaaaaca
tctactggatacagctttttgattccatggattgggaaagggctgctggttctttctggg
gatacttggtttcagcatcgaagactgatcacccctgggtttcactacgatgttctcaaa
ccttatgtcggtctcatttccgattccacaaaaatcatgctggataaactagatgccttt
tcaaataaggatgaacctgtggagctattccaacatgtcagcctgatgacactggacagt
atcatgaaatgtgcctttagttaccaaagcaactgtcagactgacatagataatgactac
attcaagctgtgtatgacctgtcctggttgactcagcagcgcattcgcacctttccttat
cacagtaacctaatttactatctgagccctcatggtttccgttttcgcaaagcctgcaga
atagcgcatctccacactgataaagtaatcgggcagaggaaaaagctcttggaaagcaag
gaagagttggagaaggtccaaaagaagaggcacttggattttctagacattctcctctgt
gccaaggatgaaaatgggcagaggctttctgatgaggatatacgcgctgaggtggacaca
ttcatgtttgagggacatgatactacatctagtggaatatcctggatcctacattgtatg
gctacacatccagagcaccagcagaaatgccaggaggagatcaatgaagtcttgggggag
cgacaaaccatggaatgggatgaccttaataggataccttataccacaatgtgtattaag
gaaagtctgcgcctataccctccagtcccatcagtatccagggagcttgccaaaccaata
acattccatgatgggaagtcattaccagcaggcattttgatatttgatcctcttcgattt
tctccagaaaattcttctaagcggcattcccatgcatttgtgccttttgctgcaggacca
aggaactgcattggacagaactttgctatgaatgagatgaaagtggctgtggcactgaca
ctgaaacgctttgagttgttaccagatctttccaagcctcccctcaagctgccacaactt
gttctgcgctccaaaaatggtatccacgtgtatctgaaaaaagcaagctga

DBGET integrated database retrieval system