KEGG   Xenopus laevis (African clawed frog): 100036775Help
Entry
100036775         CDS       T01010                                 

Gene name
cyp1a1, ahh, ahrr, cp11, cyp1, cyp1a, p1-450, p450-c, p450dx
Definition
cytochrome P450, family 1, subfamily A, polypeptide 1 (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100036775 (cyp1a1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    100036775 (cyp1a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100036775 (cyp1a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100036775 (cyp1a1)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100036775 (cyp1a1)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP1 family
   100036775 (cyp1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 526 aa AA seqDB search
MTNWIGTVAGMMANTTITEFLVASVVFAIVFLVIRSQRVKIPPGTKKLPGPMPYPVIGNL
LSLSKNPHLSLTRMSETYGDVFQIQIGTKPVLVLSGLETLKQALIRQGDEFAGRPDLFTF
RMVGDGQSMTFSSDSGEVWRARRRLAQNALKTFATSPSPTSSSSCLVEENIITEAEYLVK
KFMQLIDEKGEFDPYRYVVVSVANIICGMCFGKRYNHDDEELLNVVNLTDEFGAAAASGN
PADFIPILQYLPSSSMKAFKEINRKFIDFMQKFATEHYKTFDKNHIRDITDSLIQHSQEK
RVDENSNVQLSNQKIVNIVNDLFGAGFDTITTALSWSLMYLVAHPNIQEKIQDELDRVIG
KERRPRLSDRAQLPYTEAFIFEMFRHSSFMPFTIPHCTTKDTVLNGYFIPKGICVLVNQW
QVNHDPNLWKDPSKFYPERFLNTDGTMVNKTEMEKVMVFGLGKRRCVGEAIGRMEVFLFL
TTMLQQMQFFKQDGEKLDMSPQYGLTMKHKRCHVTAKLRFPLLTTD
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattggataggtacagttgctggcatgatggcgaatactactatcactgagttt
cttgtggcatctgtagtctttgccatcgtgtttctggtgattaggtcacaaagagtcaaa
atcccaccaggaacaaagaaattaccagggcctatgccttatcctgttattgggaatttg
ttatcattgagcaagaatccacaccttagcctgacaagaatgagtgaaacctatggtgat
gtgttccagatccagataggcacaaagcctgtgttagtccttagtgggctggagactctc
aagcaagctctgatacgacagggtgatgagtttgctggacgtccagacctctttactttc
cgcatggttggtgatggacaaagcatgactttcagcagtgattctggagaggtgtggaga
gctcgacgcaggcttgcacaaaatgccctcaaaacctttgctacttccccttcacccaca
tcatcaagttcttgtcttgttgaagaaaacattattacagaagcagaatatttagtaaag
aagttcatgcaattaattgatgagaaaggagagtttgacccctataggtacgtggtggtc
tctgttgccaatatcatctgtggcatgtgctttggtaagcgatataaccatgatgatgaa
gagctactgaatgtggtgaatcttactgatgagtttggtgcagcagctgcttcaggcaac
cctgcagacttcatcccaattctacaatatcttccaagctctagcatgaaggccttcaag
gaaatcaacagaaagttcatagacttcatgcagaaatttgccacagagcattacaaaaca
tttgacaagaaccatataagagatattactgattcactcatccaacactcccaggagaag
agagtcgatgaaaactcaaatgttcaattatcaaatcaaaaaattgtgaatatagtaaat
gacctctttggtgctgggtttgataccattaccactgctctctcatggagtctcatgtat
cttgtggcccatcctaacatacaagagaaaattcaggatgaactcgatcgggtaattggc
aaagaaagacggcctagattatcagacagagctcaactgccctatactgaagcttttata
tttgagatgttccgacattcttcttttatgccattcacaattccacattgcacaaccaaa
gacacagtgttaaatggatatttcatccccaagggaatctgtgtgctggtcaaccagtgg
caagttaatcatgatccgaacctgtggaaagatccatccaagttctatccagagcgcttc
ttaaacacagatggtacaatggtgaacaaaacagagatggaaaaagtaatggtttttggc
ttaggaaaaaggaggtgtgttggtgaagccattgggagaatggaggttttcctcttcctt
acaaccatgctgcagcagatgcaattcttcaaacaagatggagaaaaactggacatgtct
ccacagtatggactaacaatgaaacacaagcgatgtcatgttacagctaaattgcgtttt
cctttgttaaccacagattaa

DBGET integrated database retrieval system