KEGG   Xenopus laevis (African clawed frog): 100036785Help
Entry
100036785         CDS       T01010                                 

Gene name
usp3
Definition
ubiquitin specific peptidase 3 (EC:3.1.2.15)
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100036785 (usp3)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100036785 (usp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 522 aa AA seqDB search
MECPHLTTSVCIAPDSAVFPNGCPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQAPLSSHKRQEKTEKERTQHTVCMDCSSYSTYCYRCDDFVVNDTKLCLIQKVREHL
QNLENSAFTAERHRKRKFLESASLSKKLLKVNGSTTALCATGLRNLGNTCFMNAILQSLS
NIQQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDVNVSLVEEFRKTLCALWQGNQTAFS
PESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGEFDGSSHSVLSQANCSRSVS
NKCCINGASTVVTSVFGGVLQNEVNCLICGTESRKFDPFLDLSLDIPSQFRNKRCKNQEN
GPTCTLRDCLRSFTDLEELDETELYTCLKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA
YLRNKVDTYVDFPLRGLDMKSFLLEPENIGPESCLYDLEAVVVHHGSGVGSGHYTAYATH
EGRWFHFNDSTVTLTEEETVAKAKAYILFYVERQVPATTEKL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggagtgcccgcacctgaccaccagtgtttgtattgccccggactccgccgttttcccc
aacggctgtccttcctcgtggtgctgcagcgtttgtcgctcaaacaagagtccatgggtc
tgtttgacatgttccagtgtccactgtggaagatatgtaaatggtcatgcaaaaaagcat
tatgaggatgcccaggctccactcagtagccacaaacgtcaggaaaagacagaaaaggaa
cgaacgcagcatacagtatgcatggactgcagcagttacagtacgtattgttaccgatgt
gatgattttgtggtaaatgatacaaaattgtgtttaatacagaaggtccgggagcatttg
cagaatttggaaaactctgcttttactgctgagcggcatagaaaaagaaaattcctggag
agtgcctcgctgagcaagaaattgttgaaagtaaatggaagcacaactgctctatgtgct
actggccttcggaatcttggaaatacctgctttatgaatgcaattcttcaatcactcagc
aacattcagcagttttgctgttacttcaaggaattgcctgctgtggaacttcggaatggt
aaaactgccggccggcgaacctaccatacacgaagccaaggggatgttaatgtgtcactg
gttgaggaatttagaaagaccttgtgtgcattatggcagggtaaccagactgcctttagt
cctgagtcattgttctatgttgtgtggaaaataatgccaaatttcaggggatatcagcag
caagatgcccacgagtttatgcgttatctcttagaccacctccaccttgaactacaaggc
gaatttgatggctcctctcactctgtcttatcacaggcgaactgcagtcggtctgtcagt
aacaaatgttgtataaatggtgcatccactgtggtaacctcagtatttgggggagttcta
cagaatgaagttaactgcctaatttgtggaacagaatcaagaaaatttgatccattccta
gacctctctttagatattccaagccaattccgaaacaagcgttgtaagaaccaagaaaat
ggaccaacctgtaccctgcgagactgtcttcgcagctttacagacttagaggaactagat
gagacagaactctacacatgtctaaagtgcaaaaagaaacagaagtccaccaaaaagttt
tggatccagaaactaccaaaggtgctttgcctacacttgaagaggttccattggacagcc
tacttgaggaacaaagtggacacatatgtagattttcctctacgaggattggatatgaag
tcatttttgttagagccagaaaatattggtccagaaagctgtctgtatgatcttgaagct
gtagttgttcatcatggctcgggtgttgggtctggtcactacactgcctatgccacccat
gaagggcgctggttccatttcaatgacagcacagtgacacttacagaagaggagactgtg
gcaaaagcaaaagcctatattcttttttatgtggaacgccaggttcctgccacaactgag
aaactataa

DBGET integrated database retrieval system