KEGG   Xenopus laevis (African clawed frog): 100036853Help
Entry
100036853         CDS       T01010                                 

Definition
uncharacterized LOC100036853
Orthology
K10739  
replication factor A2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100036853
   03420 Nucleotide excision repair
    100036853
   03430 Mismatch repair
    100036853
   03440 Homologous recombination
    100036853
   03460 Fanconi anemia pathway
    100036853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 274 aa AA seqDB search
MWNNQGGFDGGSGMGGGGYMQSPGGFGSPAPTQGEKKSRSRSQQIVPCTVSQLLSATQND
EVFRIGETELSQVIIVGIVRHAEKAPTNILYKVDDMTAAPMDVRQWVDTDEASCENMVVP
PGSYVKVAGHLRSFQNKKSVVAFKIAPVDDMNEFVSHMLEVVHSHMVMNSQGAPSGGGST
MALNTPGRMGIGDSGGAFSGGNDNPTNGLTPHQNQILNLIKSCKGNEGMAFEELKNRLHG
MNVNSIRKTVDFLSNEGHIYSTIDDEHYKSTDGD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacaaccagggtggatttgatggtggctcaggaatgggaggcggaggttatatg
cagtctccaggaggctttgggtctcctgcacccactcaaggagagaaaaaatcgcggtcc
aggtcacagcaaatagtgccatgtacagtgtcacagctactgtcagcaacacagaatgat
gaggtgtttcgaataggagagactgaactttcacaggtcattatagttggcattgtcaga
catgccgaaaaagctccgacaaatattctttacaaagtagatgatatgactgcagcaccc
atggatgtcagacagtgggtggacacagatgaggcaagctgtgaaaatatggtggtacct
cctggtagttatgtaaaagttgctggtcaccttcgttccttccagaacaagaaaagtgtt
gtagcatttaagattgctcctgttgatgatatgaacgagtttgtttctcatatgctggaa
gttgttcactctcacatggtcatgaattcccagggtgcgccttcagggggtggttccaca
atggcccttaacacacctggacgcatgggtattggtgacagtggcggagcattctcagga
ggaaatgacaatcctacaaatggactgacaccacatcagaaccagattcttaatttgatc
aaaagctgcaaaggaaatgaaggcatggcatttgaagaactgaaaaaccgacttcatgga
atgaatgttaactcaattaggaaaactgtggactttctcagcaatgagggacacatttat
tccactattgatgatgaacattacaaatcaacggatggagattaa

DBGET integrated database retrieval system