KEGG   Xenopus laevis (African clawed frog): 100036941Help
Entry
100036941         CDS       T01010                                 

Gene name
galm.L, galm
Definition
(RefSeq) galactose mutarotase (aldose 1-epimerase) L homeolog
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00010  Glycolysis / Gluconeogenesis
xla00052  Galactose metabolism
xla01100  Metabolic pathways
Module
xla_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100036941 (galm.L)
   00052 Galactose metabolism
    100036941 (galm.L)
Enzymes [BR:xla01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100036941 (galm.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 100036941
NCBI-ProteinID: NP_001091180
Xenbase: XB-GENE-1001029
UniProt: A1L2T0
Position
5L
AA seq 342 aa AA seqDB search
MTSVTRDVFGQLLGGEGTVERFCLHSKEVRAEVISFGCIITRLETQDRNGTFSDLVLGFD
VIEGYTNKHPYFGAVIGRVANRIANGKFTVKGKDYRLAINNGPNSIHGGLKGFDKVLWAP
KIIENGVQFFYKSADGEEGYPGELNVWVTYTLIGRTLTVNYRAQSNNTTPINLTNHSYFN
LAGQGSSNVYDHVVSIDADHYLPVDDTMIPTGEVAPVLGTCFDLRKPVELGSHLKSFHLD
GFDHNFCLGVTQEQKQCARISHPLSGRVLTVSTTQPGVQFYTANFLDGSLKGKAGKVYPK
HSAFCLETQGWPDAVNKPHFPSSLLNPGEEYNHTTCFEFSLI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgtgacaagggatgtgtttggtcaattgctcggaggtgaaggaaccgtggaa
cgattttgccttcattctaaagaagtcagagctgaggtcatatcatttggctgtataata
actcgtttagaaacccaggacaggaatggaaccttttcagatctagttcttggttttgat
gtgatagaaggctatacaaacaaacacccttattttggagcagttattgggcgggtagca
aacagaattgccaatggtaaattcactgtgaaaggaaaggattatcgtttggccataaac
aatggaccgaacagtatacacggaggcctgaaagggtttgacaaagtgctctgggcccct
aagatcatagaaaatggtgtccagttcttctacaaaagtgcagacggcgaggaagggtac
cccggcgaattaaatgtgtgggtgacatacacacttattggcagaaccttgactgtgaac
tacagagcacaaagtaataacactacacctataaatctgacaaaccattcctactttaac
ttggcaggacagggctctagtaatgtttacgaccatgtggtttccattgatgctgatcat
tacctgcccgttgatgacaccatgataccaacaggggaggtggcgccagttctgggaact
tgctttgatttaaggaaaccagtagagcttggcagtcatttaaagtcgtttcatttagat
ggctttgaccacaatttttgcttgggcgtcacacaggaacagaagcaatgcgcaaggatc
agccatccgctaagtggcagggtgctaactgtcagcacaactcagcctggggtccagttc
tacactgccaatttcctggatggatctttgaagggcaaggctggtaaagtgtacccaaaa
cattcggcattttgcttggaaacacaaggctggcctgatgcagttaataagccacatttt
ccaagttctcttctaaatcctggagaagaatacaaccacactacctgttttgagttttca
cttatttag

DBGET integrated database retrieval system