KEGG   Xenopus laevis (African clawed frog): 100037114Help
Entry
100037114         CDS       T01010                                 

Definition
uncharacterized LOC100037114
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:xla01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:xla01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:xla03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 339 aa AA seqDB search
MTFRGSQTVSTILEESPSSKQEYIGADRGMTDDILDTTYIKKVDSKPPITLVWRNIILMS
LLHFGAFYGLFYVSSAKPITLAWAILCFLLSALGVTAGAHRLWSHRSYKAKLPLRIFLAV
VNSMAFQNDIFEWARDHRVHHKYSETDADPHNAVRGFFFSHIGWLLLRKHPDVIEKGKKL
DLSDLKEDKVVMFQRRNYKLSILVMCFILPTVIPWYFWGESFSVAFYVPCLLRYALVLNA
TWLVNSAAHMFGNRPYDQTINPRENPFVAIGAIGEGFHNYHHTFPYDYSTSEFGIKFNLT
TGFIDLMCLLGLASHCKSVSKETIMARKMRTGDGSHRSG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaggggcagtcagactgtatcaacgatacttgaagaaagtccttcctcaaaa
caggaatatattggggctgacagaggcatgacagatgacatacttgatactacatacatt
aaaaaagtggattccaagccacccattacattggtttggaggaatataatactgatgtct
ttgctgcactttggagcattttacggactgttttatgtatcttctgcaaagcccatcact
ttggcatgggcaattctgtgcttcttgttgagtgctcttggagtgacagctggtgcacat
cgtctctggagtcatcgttcctataaggccaagctaccccttagaatatttttggcagtt
gtaaactctatggctttccagaatgacatctttgagtgggcacgagatcaccgtgttcat
cacaaatactctgaaactgatgccgacccacataacgctgtgaggggtttcttcttttcg
cacattggttggcttctcctgcgcaaacaccccgatgtaatagaaaaagggaagaagctt
gatctgagtgacctcaaagaagataaggtggttatgttccaaaggagaaactataaactt
tccatactggtgatgtgcttcattctccccactgtgattccatggtacttctggggcgag
tcgttctctgttgccttctatgtcccttgcctcttacgttatgcactagtgctcaatgca
acatggctggtgaatagtgcagctcatatgtttggaaaccgaccatatgaccagaccatc
aatcccagggagaacccatttgtcgctattggagccataggcgaaggcttccataactac
catcacacattcccttatgactattctaccagtgaatttgggataaagttcaaccttacc
accggcttcattgaccttatgtgcctgttaggcctggctagtcactgcaagagcgtatcc
aaagagaccataatggctcggaagatgcgcactggtgatgggagccacaggagtggctga

DBGET integrated database retrieval system