KEGG   Xenopus laevis (African clawed frog): 100037114Help
Entry
100037114         CDS       T01010                                 

Definition
uncharacterized LOC100037114
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100037114
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100037114
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100037114
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100037114
Lipid biosynthesis proteins [BR:xla01004]
 Desaturase
  First
   100037114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 339 aa AA seqDB search
MTFRGSQTVSTILEESPSSKQEYIGADRGMTDDILDTTYIKKVDSKPPITLVWRNIILMS
LLHFGAFYGLFYVSSAKPITLAWAILCFLLSALGVTAGAHRLWSHRSYKAKLPLRIFLAV
VNSMAFQNDIFEWARDHRVHHKYSETDADPHNAVRGFFFSHIGWLLLRKHPDVIEKGKKL
DLSDLKEDKVVMFQRRNYKLSILVMCFILPTVIPWYFWGESFSVAFYVPCLLRYALVLNA
TWLVNSAAHMFGNRPYDQTINPRENPFVAIGAIGEGFHNYHHTFPYDYSTSEFGIKFNLT
TGFIDLMCLLGLASHCKSVSKETIMARKMRTGDGSHRSG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaggggcagtcagactgtatcaacgatacttgaagaaagtccttcctcaaaa
caggaatatattggggctgacagaggcatgacagatgacatacttgatactacatacatt
aaaaaagtggattccaagccacccattacattggtttggaggaatataatactgatgtct
ttgctgcactttggagcattttacggactgttttatgtatcttctgcaaagcccatcact
ttggcatgggcaattctgtgcttcttgttgagtgctcttggagtgacagctggtgcacat
cgtctctggagtcatcgttcctataaggccaagctaccccttagaatatttttggcagtt
gtaaactctatggctttccagaatgacatctttgagtgggcacgagatcaccgtgttcat
cacaaatactctgaaactgatgccgacccacataacgctgtgaggggtttcttcttttcg
cacattggttggcttctcctgcgcaaacaccccgatgtaatagaaaaagggaagaagctt
gatctgagtgacctcaaagaagataaggtggttatgttccaaaggagaaactataaactt
tccatactggtgatgtgcttcattctccccactgtgattccatggtacttctggggcgag
tcgttctctgttgccttctatgtcccttgcctcttacgttatgcactagtgctcaatgca
acatggctggtgaatagtgcagctcatatgtttggaaaccgaccatatgaccagaccatc
aatcccagggagaacccatttgtcgctattggagccataggcgaaggcttccataactac
catcacacattcccttatgactattctaccagtgaatttgggataaagttcaaccttacc
accggcttcattgaccttatgtgcctgttaggcctggctagtcactgcaagagcgtatcc
aaagagaccataatggctcggaagatgcgcactggtgatgggagccacaggagtggctga

DBGET integrated database retrieval system