KEGG   Xenopus laevis (African clawed frog): 100037146Help
Entry
100037146         CDS       T01010                                 

Gene name
pfkp, pfk, pfk-c, pfk1, pfkf
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100037146 (pfkp)
   01230 Biosynthesis of amino acids
    100037146 (pfkp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100037146 (pfkp)
   00030 Pentose phosphate pathway
    100037146 (pfkp)
   00051 Fructose and mannose metabolism
    100037146 (pfkp)
   00052 Galactose metabolism
    100037146 (pfkp)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100037146 (pfkp)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100037146 (pfkp)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100037146 (pfkp)
Messenger RNA biogenesis [BR:xla03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100037146 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 786 aa AA seqDB search
MAQPDKRLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMV
DGGDNIEEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAANNLVQRGITNLCVIGGD
GSLTGANLFREEWSGLLDELVQNGKIEAEATKQYAHLNIVGMVGSIDNDFCGTDMTIGTD
SALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGW
EDTMCNKLSENRARKKRLNIIIVSEGAIDCHNKPITSDLVKDLVMKRLGFDTRVTILGHV
QRGGTPSAFDRILASRMGVDCVLALLEATPETPACVVSLCGNQAVRLPLMECVQMTQEVQ
KAMDERRFDDAVRLRGRSFENNLNTYKLLSHKKNVSELPKSNFNVAVLNVGAPAAGMNAA
VRSAVRVGITEGHKMFAVNDGFEGFAKGQIKEIKWGDVGGYTGQGGSLLGTKRTLPAKYF
DQIAEQLRTHKINALLVIGGFEAYLGLLEMVEGRGKYDEFCIPMVMVPATVSNNVPGSDF
SIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEE
SFDIRELQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGRGVFDCRKNV
LGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLVETYRKDEGRVFANTDDSVCLLGMRRR
NLLFQPVTQLKDETDFKHRIPKEQWWLKMRPLMKILAKYKTSYDISDAGKLEHVNMCRRT
DEAVAI
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggcacagccagataagaggcttttcgagaatctgtccgggaagggcaaagccatcggg
gttctgacaagcggaggagatgcccaaggtatgaacgcagctgtgcgcgctgtagtgcga
atgggcatctacgtacaagccaaagtgtacttcatttatgagggataccaaggaatggtg
gatggaggagacaatattgaggaagtgtcgtgggaaagcgtttctagcatcttgcaagtg
ggtgggactgtcatcggcagtgcgcgttgcaagtccttccggacccgcgaaggtcgttta
caggcagctaataacctagttcagcggggaattaccaacctctgtgttataggaggtgat
ggtagtctgacaggtgctaacctgttccgggaagaatggagtgggcttctggatgaactc
gtacaaaatggaaaaattgaggcagaagcaactaaacagtatgcccatctgaacattgtg
ggaatggtgggatctatagataatgatttctgtggaactgatatgaccattggaactgac
tcagccctgcataggattattgaagttgttgacgccatcatgaccaccgctcagagccac
cagaggacctttgtgctggaagtcatgggaagacactgtgggtacctcgccctggtcagt
gccttagcttgtggggcagactgggtgtttatccctgaatacccaccggaggagggatgg
gaagacacaatgtgcaacaaactgtctgagaatcgtgcaaggaagaaaaggctcaatatc
atcattgtatcagaaggggctatcgactgccataataagccaatcacatcagacttggtt
aaggatctggtcatgaaacgcctgggatttgacactcgtgttacaatattgggccatgtc
caaagaggtggaaccccgtcagccttcgacagaattctggcaagtcgaatgggagtggac
tgtgtcttggccctgcttgaagctacgccagaaacgccagcatgtgttgtgtctttatgt
ggaaaccaagctgtgcgcctgccccttatggaatgtgttcagatgacccaggaagttcag
aaggccatggatgaaagaagatttgacgatgctgtacgtttacgaggaaggagctttgaa
aacaacctcaacacttacaagctgctctcccataagaaaaatgtatccgagcttccgaag
agcaatttcaatgtggctgttttgaatgtgggggcgcccgctgcgggcatgaacgctgca
gtcagatctgccgtgagagtaggaataacagagggccataaaatgttcgccgtcaacgat
ggttttgaaggatttgccaagggacagattaaagagataaaatggggagatgttggaggc
tatacaggtcaaggtggatctcttctgggaacaaagaggacccttcctgctaaatacttt
gaccaaattgcagagcaactccgaacacataaaattaatgctctacttgtcattggtgga
ttcgaggcctacttgggactgctggaaatggttgagggccgaggaaaatatgatgagttc
tgtatccctatggtcatggttcctgctactgtctccaacaatgtgcccggctcagatttc
agcattggtgcagatacagctctgaacactataactgatacctgcgatcgcatcaaacag
tcagcgagtggaaccaagcggcgcgtgtttatcatcgaaacgatgggtggctactgcggc
tacttggctaacatgggcggccttgcggctggtgcagacgcggcgtacatcttcgaagaa
tcctttgatattcgcgagctccaggcaaacgtggaacatttaacagagaaaatgaaaaca
agcatccaaagaggtctcgtactaaggaacgagaacagcaatgagaactacaccacagat
ttcatttatcagctttactcagaagaaggcagaggggtgtttgactgcagaaagaatgta
ctggggcacatgcagcaggggggcgctccttccccatttgacagaaacttcggcactaaa
atttcggctaaagctgtccagtggatttccaagaagttggtagaaacctacagaaaagat
gaaggcagggtattcgcaaacacagacgatagcgtttgtctgttagggatgcgcaggagg
aacctcctattccagccagtgactcaactcaaggatgaaacagactttaagcacaggatt
cccaaggaacagtggtggctgaagatgaggcctttgatgaagattctggccaagtacaag
acgagctacgacatttcagacgccggcaagctggaacacgttaacatgtgcagacggaca
gatgaagcggttgccatctga

DBGET integrated database retrieval system